Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099940
Gene name
Locationscaffold_7:749787..751688
Strand+
Gene length (bp)1901
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.9E-08 18 205
PF00326 Peptidase_S9 Prolyl oligopeptidase family 1.0E-07 23 215
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.9E-07 9 215
PF08538 DUF1749 Protein of unknown function (DUF1749) 1.4E-05 33 132

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07379|YD057_YEAST Putative uncharacterized protein YDL057W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL057W PE=4 SV=1 3 206 5.0E-16

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099940
MGHKDYLFQRRLAERLPFDSFRFDFRGNHETGGTWKQGAFHDDLEDIDAVVSYLKAKYGYEIELIVGHSRGSLVA
FRWISTTEEGRKVSAFINVSARHRMRKILETEGAQHWEEAFKKQGYFEWKVTVARKQVIAKINPQSVEDFCSWDT
SFVWEQFPKETDVLTIHGTADKIVPVSDAMIYARALSDRSPGTHSLHLMENADHNFTKRQDEVVKVILDCCEHNH
ILQARSTAAEVVARG*
Coding >AgabiH97|099940
ATGGGGCATAAGGACTATCTGTTCCAGCGCCGTCTTGCAGAACGCCTTCCATTTGATTCATTCCGTTTTGATTTT
CGGGGAAATCATGAAACCGGAGGTACCTGGAAACAGGGCGCCTTTCACGACGACCTGGAAGATATCGATGCAGTC
GTTTCCTATCTCAAAGCAAAATATGGGTATGAAATTGAATTGATTGTTGGTCATTCCCGTGGATCATTGGTCGCT
TTCCGATGGATATCAACAACGGAGGAAGGAAGAAAAGTATCTGCTTTCATCAACGTTTCCGCCCGGCACCGCATG
CGGAAAATACTTGAGACTGAGGGCGCCCAACATTGGGAAGAGGCATTCAAGAAACAAGGATATTTTGAATGGAAG
GTTACGGTTGCTCGCAAGCAGGTGATAGCCAAAATTAATCCTCAAAGTGTTGAGGACTTCTGCAGCTGGGATACG
TCGTTCGTTTGGGAACAGTTTCCTAAGGAAACGGATGTATTGACCATTCATGGTACTGCGGATAAGATAGTGCCT
GTGTCAGATGCGATGATTTATGCACGAGCACTCAGCGACAGATCACCTGGGACCCATTCTCTTCATCTAATGGAA
AACGCGGATCATAATTTTACGAAACGTCAAGACGAGGTAGTGAAGGTTATATTGGATTGCTGTGAACACAATCAC
ATTTTGCAGGCGAGATCCACAGCTGCTGAGGTAGTAGCTCGAGGTTAG
Transcript >AgabiH97|099940
ATGGGGCATAAGGACTATCTGTTCCAGCGCCGTCTTGCAGAACGCCTTCCATTTGATTCATTCCGTTTTGATTTT
CGGGGAAATCATGAAACCGGAGGTACCTGGAAACAGGGCGCCTTTCACGACGACCTGGAAGATATCGATGCAGTC
GTTTCCTATCTCAAAGCAAAATATGGGTATGAAATTGAATTGATTGTTGGTCATTCCCGTGGATCATTGGTCGCT
TTCCGATGGATATCAACAACGGAGGAAGGAAGAAAAGTATCTGCTTTCATCAACGTTTCCGCCCGGCACCGCATG
CGGAAAATACTTGAGACTGAGGGCGCCCAACATTGGGAAGAGGCATTCAAGAAACAAGGATATTTTGAATGGAAG
GTTACGGTTGCTCGCAAGCAGGTGATAGCCAAAATTAATCCTCAAAGTGTTGAGGACTTCTGCAGCTGGGATACG
TCGTTCGTTTGGGAACAGTTTCCTAAGGAAACGGATGTATTGACCATTCATGGTACTGCGGATAAGATAGTGCCT
GTGTCAGATGCGATGATTTATGCACGAGCACTCAGCGACAGATCACCTGGGACCCATTCTCTTCATCTAATGGAA
AACGCGGATCATAATTTTACGAAACGTCAAGACGAGGTAGTGAAGGTTATATTGGATTGCTGTGAACACAATCAC
ATTTTGCAGGCGAGATCCACAGCTGCTGAGGTAGTAGCTCGAGGTTAG
Gene >AgabiH97|099940
ATGGGGTGAGTGAAGTACCGAGGCGTTTTTCAAGTCTTCCGACTCGGTAGGAGCGCTATGAAGTGATCGAATCTC
CTTTTGGTTCTCATCGCTCCGAACGAAGTTTAATGAAAGTGCATCTCGGTCTTTCGTCGGAAATGTGTCGGAAGC
TCTCGGTGGCGTCCACCAAGTTGTATCTTCAATATTGACCTTTCTTGTTCAGGCATAAGGACTATCTGTTCCAGC
GCCGTCTTGCAGAACGCCTTCCATTTGATTCATTCCGTTTTGATTTTCGGTAAGTCCGCGACCGCCAACTGTCCC
GTTAACCATTTCTCACTTACAGCCTCTCTATCTACTTTGTGATTTTGCGGGATCGTCGTACAACCCCACCTATGA
TCCTTCAACGGCGCTATCACTTAACCAAAGGGGAAATCATGAAACCGGAGGTACCTGGAAACAGGGCGCCTTTCA
CGACGACCTGGAAGATATCGATGCAGTCGTTTCCTATCTCAAAGCAAAATATGGGTATGAAATTGAATTGATTGT
TGGTCATTCCCGTGGATCATTGGTCGCTTTCCGATGGATATCAACAACGGAGGAAGGAAGAAAAGTATCTGCTTT
CATCAACGTTTCCGCCCGGCACCGCATGCGGGTAAGTCTTTCTGACTTCCCCCAACCCAACCTAAAGTCCGAATC
GAGTCTCATCAACTTTGATCTGCTCTCCGTCTCCGAAAACCCCGTATCGTTCGCTCACTTTTCTATTTCTCTCCT
TCCGGTTGCCCCTTTTACCTGTTGACGTGTACTGCCAACAACATGACGCTGTAACGCAACTGCGCGAAAACCGAA
CCCTGCGTATGCTGATGTGCCATGGCTTAACATGATCCTGATTTCCCCACAACATAAAGTAGAAAATACTTGGTA
ATGATCTATATCATATCAATCTTGTTTGAGATCAATTTACTGACTTAACTTTTTTTTTTTTTGGTTCTTTTTGTA
ATTTTTTCTCCCCATATGTGACGTTGCCTCTTTGGGACCATGTATGACTCGGTTCTATCCAAACACGATCCAATC
GCCTTTGGCCCTGCCTTCGAATTCGCCTTTCCAAATTACTTGTCTTTGACGTCCGCTCCCCTTATTACTCAATCG
GGGCTTGATGACCATTTCTGGGTCTCGGGCTATGTATCATCGGTGGGGCCTCATTAGAGACTGAGGGCGCCCAAC
ATTGGGAAGAGGCATTCAAGAAACAAGGATATTTTGAATGGAAGGTTACGGTTGCTCGCAAGCAGGTGATAGCCA
AAATTAATCCTCAAAGTGTTGAGGACTTCTGCAGCTGGGATACGTCGTTCGTTTGGGAACAGTTTCCTAAGGAAA
CGGATGTATTGACCATTCATGGTACTGCGGATAAGATAGTGCCTGTGTGAGAACTTCTTTTCTATTCTTTTTCGT
TGTTCATCTCAAACGCCGCATCTCTCGGCTACTGTTGGTATCGGTCTTCAATTTATTTTTTCTCAACTGCTGCGA
AACACGATCTTGTTACTGACGAAAGATTTTTGTTTCGTGGCGGTTGTCTATTACGATGATCAAACAGGTCAGATG
CGATGATTTATGCACGAGCACTCAGCGACAGATCACCTGGGACCCATTCTCTTCATCTAATGGAAAACGCGGATC
ATAATTTTACGAAACGTCAAGACGAGGTAGTGAAGGTTATATTGGATTGGTGGGAAGCTCGACAACGAGGAGAAG
TGACCACTGGTATCTGGTTAACGGAGATAAATCCAAGCACTGCCAAGCTGTGAACACAATCACGTAGGTGTCAGA
CGCAAAATCTCATTTATGGGCATTTGGGTACTGATGGTAACGCCGGATATTAGATTTTGCAGGCGAGATCCACAG
CTGCTGAGGTAGTAGCTCGAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail