Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099870
Gene name
Locationscaffold_7:732229..734481
Strand+
Gene length (bp)2252
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09471 Peptidase_M64 IgA Peptidase M64 2.2E-26 74 433

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099870
MVLNRVLNILLFGLGVQASTGYLGDAQQQPMSMSKTGESNVCAMHGGSLPSFGYAKDGSHSVSALSPTLAIRPLA
VSGPPENRVDLVFFSDGYTIEEMDKFFTDAKRLADDISQNQTFFTVRPLLNFWGAFTPSEESGIGADGVPKKTPY
GLYREGTELRAVYYARPEVAHAACDSMGDQCNYPILLGNDPLYGGLGGEFTVITSSILNGPLVLRHELGHSIIDV
GEEYDGGFAYFGVNAVQDAHEPVSWDHWLSTPPSTSGSINSDARVERSVMPMQTYPWTLLNTTESWSIKFPASGL
YFRHVVRFSLSGLPEATDLRVELDGIELDWVPKEGLGLDRWHYDIHRAGGLSDGEHILSFTLLNQEREGVAQLCS
AEILEFGDEDEFVSSPGFYSLYPTFSDKNETSYRPTNEDCLMRIVTSPDLCKVCTEGLWIHLLKSVNLIDDLTES
CTHSSSTWTKILTLDLVPLAHLRNPEENNEPINNESYAIIWKKDGIVLNEFANMTSIAIEDNNNNDEEVLGRYEV
FVKFSTDEIRLDEEGRTSSSRVYDVTTHCEDD*
Coding >AgabiH97|099870
ATGGTACTTAATCGTGTACTCAACATCTTGCTCTTCGGCCTCGGGGTTCAAGCTTCCACGGGATATCTGGGAGAT
GCCCAACAACAACCAATGTCAATGTCAAAGACTGGTGAATCAAATGTTTGTGCGATGCACGGCGGCTCCTTGCCG
TCATTTGGATACGCTAAAGATGGTTCACACTCTGTATCCGCATTAAGTCCCACTCTGGCAATTCGACCGTTGGCC
GTGTCTGGTCCTCCTGAAAACAGAGTGGACTTGGTCTTCTTTTCAGATGGATACACCATTGAAGAAATGGACAAG
TTCTTTACAGATGCGAAACGTCTCGCGGATGACATCTCGCAGAATCAAACCTTCTTCACCGTCAGACCTCTCCTC
AACTTTTGGGGAGCATTTACCCCAAGCGAAGAGAGTGGCATCGGCGCTGATGGTGTCCCGAAAAAGACACCATAT
GGACTCTATCGTGAAGGAACAGAATTGCGAGCTGTCTATTATGCTAGACCCGAAGTTGCTCATGCTGCTTGTGAC
TCCATGGGAGATCAATGCAACTATCCAATTCTGCTCGGTAACGATCCATTATATGGAGGATTGGGTGGTGAATTC
ACAGTCATCACGTCGTCCATCCTCAATGGGCCTCTAGTTCTCCGCCATGAGCTCGGACATTCCATTATTGATGTC
GGAGAAGAATACGATGGAGGTTTCGCTTATTTTGGTGTCAATGCAGTCCAAGATGCCCACGAGCCCGTCTCATGG
GATCATTGGCTCTCTACCCCTCCAAGTACATCGGGCTCCATCAATTCAGACGCTCGAGTTGAACGTTCAGTAATG
CCGATGCAAACATATCCTTGGACTCTTCTCAACACTACCGAATCTTGGTCTATCAAATTCCCAGCTTCCGGTCTT
TACTTCCGACATGTAGTGCGATTCTCCCTTTCAGGACTTCCTGAAGCTACGGACCTTCGTGTTGAGTTGGATGGA
ATTGAGCTAGATTGGGTTCCTAAAGAGGGTCTGGGTTTGGACCGATGGCATTATGATATTCATCGTGCTGGCGGC
TTAAGCGATGGTGAACATATTTTGTCGTTCACCCTCTTGAACCAGGAAAGAGAAGGTGTTGCGCAATTGTGTAGC
GCTGAAATTTTAGAATTTGGTGATGAGGATGAGTTTGTCTCGTCACCAGGATTCTACAGTCTTTACCCAACATTC
TCAGATAAGAATGAAACATCCTATCGACCTACAAACGAAGATTGCCTCATGCGTATCGTCACCTCACCCGATTTA
TGCAAAGTCTGCACGGAAGGATTATGGATCCATCTTCTCAAAAGTGTCAATCTCATCGATGACTTGACCGAATCA
TGTACACATTCATCATCCACTTGGACCAAAATACTCACGTTGGACCTCGTACCTCTCGCACATCTTCGTAACCCA
GAAGAAAACAATGAACCCATCAACAACGAATCATACGCCATCATTTGGAAAAAAGATGGTATTGTATTAAATGAA
TTCGCAAACATGACTTCTATCGCCATCGAGGATAACAACAACAACGATGAAGAAGTTTTAGGTCGATATGAAGTT
TTCGTCAAATTTTCGACTGATGAGATTCGTCTGGATGAAGAAGGACGAACGAGCTCAAGTAGGGTGTATGATGTC
ACTACTCATTGCGAGGATGACTAG
Transcript >AgabiH97|099870
ATGGTACTTAATCGTGTACTCAACATCTTGCTCTTCGGCCTCGGGGTTCAAGCTTCCACGGGATATCTGGGAGAT
GCCCAACAACAACCAATGTCAATGTCAAAGACTGGTGAATCAAATGTTTGTGCGATGCACGGCGGCTCCTTGCCG
TCATTTGGATACGCTAAAGATGGTTCACACTCTGTATCCGCATTAAGTCCCACTCTGGCAATTCGACCGTTGGCC
GTGTCTGGTCCTCCTGAAAACAGAGTGGACTTGGTCTTCTTTTCAGATGGATACACCATTGAAGAAATGGACAAG
TTCTTTACAGATGCGAAACGTCTCGCGGATGACATCTCGCAGAATCAAACCTTCTTCACCGTCAGACCTCTCCTC
AACTTTTGGGGAGCATTTACCCCAAGCGAAGAGAGTGGCATCGGCGCTGATGGTGTCCCGAAAAAGACACCATAT
GGACTCTATCGTGAAGGAACAGAATTGCGAGCTGTCTATTATGCTAGACCCGAAGTTGCTCATGCTGCTTGTGAC
TCCATGGGAGATCAATGCAACTATCCAATTCTGCTCGGTAACGATCCATTATATGGAGGATTGGGTGGTGAATTC
ACAGTCATCACGTCGTCCATCCTCAATGGGCCTCTAGTTCTCCGCCATGAGCTCGGACATTCCATTATTGATGTC
GGAGAAGAATACGATGGAGGTTTCGCTTATTTTGGTGTCAATGCAGTCCAAGATGCCCACGAGCCCGTCTCATGG
GATCATTGGCTCTCTACCCCTCCAAGTACATCGGGCTCCATCAATTCAGACGCTCGAGTTGAACGTTCAGTAATG
CCGATGCAAACATATCCTTGGACTCTTCTCAACACTACCGAATCTTGGTCTATCAAATTCCCAGCTTCCGGTCTT
TACTTCCGACATGTAGTGCGATTCTCCCTTTCAGGACTTCCTGAAGCTACGGACCTTCGTGTTGAGTTGGATGGA
ATTGAGCTAGATTGGGTTCCTAAAGAGGGTCTGGGTTTGGACCGATGGCATTATGATATTCATCGTGCTGGCGGC
TTAAGCGATGGTGAACATATTTTGTCGTTCACCCTCTTGAACCAGGAAAGAGAAGGTGTTGCGCAATTGTGTAGC
GCTGAAATTTTAGAATTTGGTGATGAGGATGAGTTTGTCTCGTCACCAGGATTCTACAGTCTTTACCCAACATTC
TCAGATAAGAATGAAACATCCTATCGACCTACAAACGAAGATTGCCTCATGCGTATCGTCACCTCACCCGATTTA
TGCAAAGTCTGCACGGAAGGATTATGGATCCATCTTCTCAAAAGTGTCAATCTCATCGATGACTTGACCGAATCA
TGTACACATTCATCATCCACTTGGACCAAAATACTCACGTTGGACCTCGTACCTCTCGCACATCTTCGTAACCCA
GAAGAAAACAATGAACCCATCAACAACGAATCATACGCCATCATTTGGAAAAAAGATGGTATTGTATTAAATGAA
TTCGCAAACATGACTTCTATCGCCATCGAGGATAACAACAACAACGATGAAGAAGTTTTAGGTCGATATGAAGTT
TTCGTCAAATTTTCGACTGATGAGATTCGTCTGGATGAAGAAGGACGAACGAGCTCAAGTAGGGTGTATGATGTC
ACTACTCATTGCGAGGATGACTAG
Gene >AgabiH97|099870
ATGGTACTTAATCGTGTACTCAACATCTTGCTCTTCGGCCTCGGGGTTCAAGGTACGTACGGCAGCACGCTCCTT
CGACTTTTACTCAATTGGAATATGGTATTTTTGTTATCTGGACGACTTGTCAGCTTCCACGGGATATCTGGGAGA
TGCCCAACAACAACCAATGTCAATGTCAAAGACTGGTGAATCAAATGTTTGTGCGATGCACGGCGGCTCCTTGCC
GTCATTTGGATACGCTAAAGATGGTTCACACTCTGTATCCGTATGTCAGGTTTTGCGTTGCAAGAATTATCTACC
TACTCTGAAGTCCAGGCATTAAGTCCCACTCTGGCAATTCGACCGTTGGCCGTGTCTGGTCCTCCTGAAAACAGA
GTGGACTTGGTCTTCTTTTCAGATGGATGTACGTTCTTGATATCGTTTTCTGCCGTCGGACCAGTTGAATTCTTA
TCTTGTCATAGACACCATTGAAGAAATGGACAAGTTCTTTACAGATGCGAAACGTCTCGCGGATGACATCTCGCA
GAATCAAACCTTCTTCACCGTCAGACCTCTCCTCAACTTTTGGGGAGCATTTACCCCAAGCGAAGAGGTTGGTCA
CATAACCTCGTCCTCGTTGTCAAATAGATGCCATAACGCATTTATAGAGTGGCATCGGCGCTGATGGTGTCCCGA
AAAAGTATTGCTTCTCGCTTTAGCTTTTCAAAGGGGAACAAGGCCGTTGATTAATTTGCAGGACACCATATGGAC
TCTATCGTGAAGGAACAGAATTGCGAGCTGTCTATTATGCTAGACCCGAAGTTGCTCATGCTGCTTGTGACTCCA
TGGGAGATCAATGCAACTATCCAATTCTGCTCGGCAAGTCCTGCGCGATGTGTTCGAAAATGCAATCGTCTAACA
ATGTGAATTACAGGTAACGATCCATTATATGGAGGTAAGTACATGCGCCATTTGGGGTTATAAATTTGAACATGA
TATTCCTCAATAGGATTGGGTGGTGAATTCACGTACGTCCCTCCTTACATGAAATCGTTATGCCTCTGAAATAGT
GTTGCCTCCAAACATAGAGTCATCACGTCGTCCATCCTCAATGGGCCTCTAGTTCTCCGCCATGAGCTCGGACAT
TCCATTATTGATGTCGGAGAAGAATACGATGGAGGTTTCGCTTATTTTGGTGTCAATGCAGTCCAAGATGCCCAC
GAGCCCGTCTCATGGGATCATTGGCTCTCTACCCCTCCAAGTACATCGGGCTCCATCAATTCAGACGCTCGAGTT
GAACGTTCAGTAATGCCGATGCAAACATATCCTTGGACTCTTCTCAACACTACCGAATCTTGGTCTATCAAATTC
CCAGCTTCCGGTCTTTACTTCCGACATGTAGTGCGATTCTCCCTTTCAGGACTTCCTGAAGCTACGGACCTTCGT
GTTGAGTTGGATGGAATTGAGCTAGATTGGGTTCCTAAAGAGGGTCTGGGTTTGGACCGATGGCATTATGATATT
CATCGTGCTGGCGGCTTAAGCGATGGTGAACATATTTTGTCGTTCACCCTCTTGAACCAGGAAAGAGAAGGTGTT
GCGCAATTGTGTAGCGCTGAAATTTTAGAATTTGGTGATGAGGATGAGTGTGTAATCATCATGCCAAAAGAAATC
TTCTACAGCTGACTTAATGTTCGATAGGTTTGTCTCGTCACCAGGATTCTACAGTCTTTACCCAACGTGAGTCTA
GTTCACCACGATAATTTCAACATGCGCATCTTACCCAAAACTTATCTAGATTCTCAGATAAGAATGAAACATCCT
ATCGACCTACAAACGAAGATTGCCTCATGCGTATCGTCACCTCACCCGATTTATGCAAAGTCTGCACGGAAGGAT
TATGGATCCATCTTCTCAAAAGTGTCAATCTCATCGATGACTTGACCGAATCATGTACACATTCATCATCCACTT
GGACCAAAATACTCACGTTGGACCTCGTACCTCTCGCACATCTTCGTAACCCAGAAGAAAACAATGAACCCATCA
ACAACGAATCATACGCCATCATTTGGAAAAAAGATGGTATTGTATTAAATGAATTCGCAAACATGACTTCTATCG
CCATCGAGGATAACAACAACAACGATGAAGAAGTTTTAGGTCGATATGAAGTTTTCGTCAAATTTTCGACTGATG
AGATTCGTCTGGATGAAGAAGGACGAACGAGCTCAAGTAGGGTGTATGATGTCACTACTCATTGCGAGGATGACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail