Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099580
Gene name
Locationscaffold_7:669965..670723
Strand+
Gene length (bp)758
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 7.6E-22 63 162
PF13847 Methyltransf_31 Methyltransferase domain 7.9E-19 58 179
PF08241 Methyltransf_11 Methyltransferase domain 1.8E-18 64 166
PF13489 Methyltransf_23 Methyltransferase domain 5.6E-15 48 180
PF08242 Methyltransf_12 Methyltransferase domain 4.7E-12 64 164
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.2E-11 51 174
PF05175 MTS Methyltransferase small domain 4.5E-10 53 164
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.0E-10 56 178
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 2.9E-08 43 133
PF05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase 1.6E-05 59 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 59 169 8.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 14 169 2.0E-08
sp|C6E228|CMOA_GEOSM tRNA (cmo5U34)-methyltransferase OS=Geobacter sp. (strain M21) GN=cmoA PE=3 SV=1 60 198 3.0E-07
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 57 203 5.0E-07
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 58 202 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 59 169 8.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 14 169 2.0E-08
sp|C6E228|CMOA_GEOSM tRNA (cmo5U34)-methyltransferase OS=Geobacter sp. (strain M21) GN=cmoA PE=3 SV=1 60 198 3.0E-07
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 57 203 5.0E-07
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 58 202 7.0E-07
sp|P54458|YQEM_BACSU Putative methyltransferase YqeM OS=Bacillus subtilis (strain 168) GN=yqeM PE=3 SV=1 57 170 8.0E-07
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 57 164 8.0E-07
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 57 164 8.0E-07
sp|E5KIC0|CYPM_STRSQ Cypemycin N-terminal methyltransferase OS=Streptomyces sp. GN=cypM PE=1 SV=1 27 173 8.0E-07
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 14 169 9.0E-07
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 43 167 1.0E-06
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 52 166 1.0E-06
sp|D5DIV9|BIOC_BACMD Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus megaterium (strain DSM 319) GN=bioC PE=3 SV=1 20 168 2.0E-06
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 57 165 3.0E-06
sp|C1DHS2|UBIE_AZOVD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 54 165 5.0E-06
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 54 165 6.0E-06
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 54 165 7.0E-06
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 54 165 7.0E-06
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 54 165 7.0E-06
sp|A3QEP9|CMOA_SHELP tRNA (cmo5U34)-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cmoA PE=3 SV=1 61 174 7.0E-06
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 43 167 8.0E-06
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 57 164 8.0E-06
sp|C6CWS7|BIOC_PAESJ Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 62 168 9.0E-06
sp|O05972|Y028_RICPR Uncharacterized protein RP028 OS=Rickettsia prowazekii (strain Madrid E) GN=RP028 PE=4 SV=1 59 163 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0006396 RNA processing Yes
GO:0008173 RNA methyltransferase activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0016070 RNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099580
MSRNAAPIILRPPEDDIEKRHLVARGYDQCAVTYFNWQRARKMPTEEAYLQKLLTRLKQGSRVLELGCGPGVPFT
KMLAEAHERKLEIVAVDVSASQVNLAQQTIQKNEFPNVKFVRADMTEIGFNRMHFDAVVSFYTWFHLPKEEQGAM
AERITRWLKPGGILLFNTSSVAEEIVWQNWMGVNMYINSLGVKGTLDLLKEYARELEVTDEIVSEKVGNQEENFL
WIWAVKRL*
Coding >AgabiH97|099580
ATGTCCAGAAATGCAGCTCCGATAATCCTTCGCCCCCCTGAAGATGATATCGAGAAAAGGCATCTTGTGGCGCGA
GGCTACGATCAATGCGCAGTAACCTATTTTAACTGGCAGAGAGCTCGAAAGATGCCCACAGAAGAAGCGTATCTC
CAGAAACTCCTCACCCGACTCAAGCAGGGATCGCGTGTTCTGGAATTAGGTTGTGGACCTGGCGTTCCTTTCACC
AAAATGCTGGCCGAAGCCCATGAAAGAAAACTTGAAATCGTAGCAGTCGACGTCTCCGCTTCTCAAGTGAATTTA
GCACAACAGACTATCCAAAAGAATGAATTTCCGAATGTCAAGTTCGTTCGTGCGGATATGACGGAAATAGGATTC
AATCGAATGCATTTCGATGCTGTGGTGTCGTTTTATACGTGGTTCCATTTACCCAAGGAAGAACAGGGAGCTATG
GCAGAGAGGATTACGAGGTGGTTGAAACCTGGAGGAATCTTGTTGTTCAACACCTCGAGTGTTGCGGAAGAGATA
GTTTGGCAGAACTGGATGGGCGTCAACATGTATATCAATTCCTTGGGTGTCAAGGGGACTTTGGACTTGTTAAAG
GAATACGCGAGAGAGTTGGAAGTGACGGATGAGATTGTGTCTGAGAAGGTGGGGAATCAAGAGGAGAACTTCCTT
TGGATATGGGCTGTCAAGAGATTGTAA
Transcript >AgabiH97|099580
ATGTCCAGAAATGCAGCTCCGATAATCCTTCGCCCCCCTGAAGATGATATCGAGAAAAGGCATCTTGTGGCGCGA
GGCTACGATCAATGCGCAGTAACCTATTTTAACTGGCAGAGAGCTCGAAAGATGCCCACAGAAGAAGCGTATCTC
CAGAAACTCCTCACCCGACTCAAGCAGGGATCGCGTGTTCTGGAATTAGGTTGTGGACCTGGCGTTCCTTTCACC
AAAATGCTGGCCGAAGCCCATGAAAGAAAACTTGAAATCGTAGCAGTCGACGTCTCCGCTTCTCAAGTGAATTTA
GCACAACAGACTATCCAAAAGAATGAATTTCCGAATGTCAAGTTCGTTCGTGCGGATATGACGGAAATAGGATTC
AATCGAATGCATTTCGATGCTGTGGTGTCGTTTTATACGTGGTTCCATTTACCCAAGGAAGAACAGGGAGCTATG
GCAGAGAGGATTACGAGGTGGTTGAAACCTGGAGGAATCTTGTTGTTCAACACCTCGAGTGTTGCGGAAGAGATA
GTTTGGCAGAACTGGATGGGCGTCAACATGTATATCAATTCCTTGGGTGTCAAGGGGACTTTGGACTTGTTAAAG
GAATACGCGAGAGAGTTGGAAGTGACGGATGAGATTGTGTCTGAGAAGGTGGGGAATCAAGAGGAGAACTTCCTT
TGGATATGGGCTGTCAAGAGATTGTAA
Gene >AgabiH97|099580
ATGTCCAGAAATGCAGCTCCGATAATCCTTCGCCCCCCTGAAGAGTGAGTATAGTTGTGGATGTCACCAAGCAAA
AGCGCTCACCTAGTCATTTTCGAAGTGATATCGAGAAAAGGCATCTTGTGGCGCGAGGCTACGATCAATGCGCAG
TAACCTATTTTAACTGGCAGAGAGCTCGAAAGATGCCCACAGAAGAAGCGTATCTCCAGAAACTCCTCACCCGAC
TCAAGCAGGGATCGCGTGTTCTGGAATTAGGTTGTGGACCTGGCGTTCCTTTCACCAAAATGCTGGCCGAAGCCC
ATGAAAGAAAACTTGAAATCGTAGCAGTCGACGTCTCCGCTTCTCAAGTGAATTTAGCACAACAGACTATCCAAA
AGAATGAATTTCCGAATGTCAAGTTCGTTCGTGCGGATATGACGGAAATAGGATTCAATCGAATGCATTTCGATG
CTGTGGTGTCGTTTTATACGTGGTTCCATTTACCCAAGGAAGAACAGGGAGCTATGGCAGAGAGGATTACGAGGT
GGTTGAAACCTGGAGGAATCTTGTTGTTCAACACCTCGAGTGTTGCGGAAGAGATAGTTTGGCAGAACTGGATGG
GCGTCAACATGTATATCAATTCCTTGGGTGTCAAGGGGACTTTGGACTTGTTAAAGGAATACGCGAGAGAGTTGG
AAGTGACGGATGAGATTGTGTCTGAGAAGGTGGGGAATCAAGAGGAGAACTTCCTTTGGATATGGGCTGTCAAGA
GATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail