Protein ID | AgabiH97|099540 |
Gene name | |
Location | scaffold_7:661671..662979 |
Strand | - |
Gene length (bp) | 1308 |
Transcript length (bp) | 1023 |
Coding sequence length (bp) | 1023 |
Protein length (aa) | 341 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 5.3E-44 | 19 | 314 |
PF13738 | Pyr_redox_3 | Pyridine nucleotide-disulphide oxidoreductase | 5.1E-14 | 125 | 301 |
PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase | 9.1E-14 | 171 | 241 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6C7L4|TRXB_YARLI | Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 | 17 | 333 | 7.0E-176 |
sp|Q92375|TRXB_SCHPO | Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 | 17 | 334 | 5.0E-167 |
sp|Q6FR39|TRXB_CANGA | Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 | 17 | 333 | 3.0E-166 |
sp|P51978|TRXB_NEUCR | Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 | 16 | 334 | 1.0E-165 |
sp|Q6HA24|TRXB_KLULA | Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 | 14 | 333 | 3.0E-165 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6C7L4|TRXB_YARLI | Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 | 17 | 333 | 7.0E-176 |
sp|Q92375|TRXB_SCHPO | Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 | 17 | 334 | 5.0E-167 |
sp|Q6FR39|TRXB_CANGA | Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 | 17 | 333 | 3.0E-166 |
sp|P51978|TRXB_NEUCR | Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 | 16 | 334 | 1.0E-165 |
sp|Q6HA24|TRXB_KLULA | Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 | 14 | 333 | 3.0E-165 |
sp|Q6BIS1|TRXB_DEBHA | Thioredoxin reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRR1 PE=3 SV=1 | 16 | 333 | 2.0E-164 |
sp|P29509|TRXB1_YEAST | Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3 | 16 | 333 | 7.0E-164 |
sp|P38816|TRXB2_YEAST | Thioredoxin reductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR2 PE=1 SV=1 | 9 | 333 | 4.0E-163 |
sp|Q75CM8|TRXB_ASHGO | Thioredoxin reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRR1 PE=3 SV=2 | 16 | 333 | 5.0E-162 |
sp|Q8J0U0|TRXB_PNEJI | Thioredoxin reductase OS=Pneumocystis jiroveci GN=TRR1 PE=2 SV=1 | 16 | 321 | 2.0E-155 |
sp|P43496|TRXB_PENCH | Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 | 16 | 333 | 6.0E-154 |
sp|Q7Z7S3|TRXB_PNECA | Thioredoxin reductase OS=Pneumocystis carinii GN=TRR1 PE=2 SV=1 | 16 | 321 | 5.0E-153 |
sp|Q39242|TRXB2_ARATH | Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2 | 18 | 331 | 5.0E-142 |
sp|Q54UU8|TRXB_DICDI | Thioredoxin reductase OS=Dictyostelium discoideum GN=trrA PE=3 SV=1 | 19 | 330 | 7.0E-135 |
sp|Q39243|TRXB1_ARATH | Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=3 | 17 | 331 | 1.0E-134 |
sp|Q69PS6|NTRA_ORYSJ | Thioredoxin reductase NTRA OS=Oryza sativa subsp. japonica GN=Os06g0327300 PE=3 SV=2 | 16 | 331 | 2.0E-132 |
sp|Q6ZFU6|NTRB_ORYSJ | Thioredoxin reductase NTRB OS=Oryza sativa subsp. japonica GN=NTRB PE=2 SV=1 | 16 | 331 | 2.0E-132 |
sp|Q9Z8M4|TRXB_CHLPN | Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1 | 16 | 329 | 1.0E-122 |
sp|O84101|TRXB_CHLTR | Thioredoxin reductase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxB PE=3 SV=2 | 17 | 329 | 7.0E-117 |
sp|Q9PKT7|TRXB_CHLMU | Thioredoxin reductase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxB PE=3 SV=1 | 17 | 329 | 9.0E-117 |
sp|Q70G58|NTRC_ORYSJ | Thioredoxin reductase NTRC OS=Oryza sativa subsp. japonica GN=Os07g0657900 PE=1 SV=2 | 20 | 338 | 2.0E-111 |
sp|O22229|TRXB3_ARATH | NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana GN=NTRC PE=1 SV=2 | 20 | 338 | 7.0E-110 |
sp|Q1RJD8|TRXB_RICBR | Thioredoxin reductase OS=Rickettsia bellii (strain RML369-C) GN=trxB PE=3 SV=1 | 15 | 329 | 2.0E-104 |
sp|Q4ULP1|TRXB_RICFE | Thioredoxin reductase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxB PE=3 SV=1 | 15 | 329 | 8.0E-102 |
sp|Q68WT3|TRXB_RICTY | Thioredoxin reductase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxB PE=3 SV=1 | 15 | 329 | 2.0E-100 |
sp|Q9ZD97|TRXB_RICPR | Thioredoxin reductase OS=Rickettsia prowazekii (strain Madrid E) GN=trxB PE=3 SV=1 | 15 | 329 | 6.0E-100 |
sp|Q92I02|TRXB_RICCN | Thioredoxin reductase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxB PE=3 SV=1 | 15 | 329 | 1.0E-99 |
sp|P9WHH1|TRXB_MYCTU | Thioredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxB PE=1 SV=1 | 7 | 339 | 2.0E-97 |
sp|P9WHH0|TRXB_MYCTO | Thioredoxin reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxB PE=3 SV=1 | 7 | 339 | 2.0E-97 |
sp|O30973|TRXB_MYCSM | Thioredoxin reductase OS=Mycobacterium smegmatis GN=trxB PE=3 SV=1 | 13 | 333 | 1.0E-93 |
sp|P52215|TRXB_STRCO | Thioredoxin reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxB PE=2 SV=3 | 19 | 330 | 2.0E-92 |
sp|Q9KSS4|TRXB_VIBCH | Thioredoxin reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trxB PE=3 SV=1 | 17 | 329 | 4.0E-92 |
sp|P46843|TRXB_MYCLE | Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 | 19 | 339 | 7.0E-91 |
sp|P39916|TRXB_COXBU | Thioredoxin reductase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=trxB PE=3 SV=2 | 13 | 329 | 1.0E-90 |
sp|P43788|TRXB_HAEIN | Thioredoxin reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxB PE=3 SV=1 | 17 | 333 | 2.0E-90 |
sp|P0A9P4|TRXB_ECOLI | Thioredoxin reductase OS=Escherichia coli (strain K12) GN=trxB PE=1 SV=2 | 17 | 329 | 2.0E-89 |
sp|P0A9P5|TRXB_ECO57 | Thioredoxin reductase OS=Escherichia coli O157:H7 GN=trxB PE=3 SV=2 | 17 | 329 | 2.0E-89 |
sp|Q05741|TRXB_STRC2 | Thioredoxin reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxB PE=1 SV=3 | 19 | 337 | 6.0E-89 |
sp|Q93HX6|GLCAL_PSEFL | Glucosaminate ammonia-lyase OS=Pseudomonas fluorescens PE=1 SV=2 | 17 | 329 | 4.0E-86 |
sp|Q8T6Z1|TRXB_SPIBA | Thioredoxin reductase (Fragment) OS=Spironucleus barkhanus GN=TRXB PE=2 SV=1 | 20 | 330 | 6.0E-79 |
sp|P81433|TRXB_BUCAP | Thioredoxin reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxB PE=3 SV=1 | 15 | 329 | 3.0E-77 |
sp|Q89AJ2|TRXB_BUCBP | Thioredoxin reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxB PE=3 SV=1 | 17 | 332 | 2.0E-72 |
sp|P57399|TRXB_BUCAI | Thioredoxin reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxB PE=3 SV=1 | 17 | 329 | 2.0E-72 |
sp|P80880|TRXB_BACSU | Thioredoxin reductase OS=Bacillus subtilis (strain 168) GN=trxB PE=1 SV=3 | 20 | 334 | 2.0E-68 |
sp|O32823|TRXB_LISMO | Thioredoxin reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxB PE=3 SV=1 | 20 | 334 | 2.0E-66 |
sp|Q928B5|TRXB_LISIN | Thioredoxin reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxB PE=3 SV=1 | 20 | 329 | 2.0E-66 |
sp|Q8CPY8|TRXB_STAES | Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 | 20 | 331 | 4.0E-66 |
sp|Q5HQW4|TRXB_STAEQ | Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 | 20 | 331 | 4.0E-66 |
sp|P94284|TRXB_BORBU | Thioredoxin reductase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxB PE=3 SV=2 | 5 | 325 | 6.0E-66 |
sp|P66011|TRXB_STAAW | Thioredoxin reductase OS=Staphylococcus aureus (strain MW2) GN=trxB PE=1 SV=1 | 20 | 329 | 2.0E-65 |
sp|Q6GB66|TRXB_STAAS | Thioredoxin reductase OS=Staphylococcus aureus (strain MSSA476) GN=trxB PE=3 SV=1 | 20 | 329 | 2.0E-65 |
sp|P99101|TRXB_STAAN | Thioredoxin reductase OS=Staphylococcus aureus (strain N315) GN=trxB PE=1 SV=1 | 20 | 329 | 2.0E-65 |
sp|P66010|TRXB_STAAM | Thioredoxin reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxB PE=3 SV=1 | 20 | 329 | 2.0E-65 |
sp|Q5HHQ4|TRXB_STAAC | Thioredoxin reductase OS=Staphylococcus aureus (strain COL) GN=trxB PE=3 SV=1 | 20 | 329 | 2.0E-65 |
sp|Q6GIM7|TRXB_STAAR | Thioredoxin reductase OS=Staphylococcus aureus (strain MRSA252) GN=trxB PE=3 SV=1 | 20 | 329 | 9.0E-65 |
sp|P52213|TRXB_CLOLI | Thioredoxin reductase OS=Clostridium litorale GN=trxB PE=3 SV=1 | 20 | 331 | 5.0E-59 |
sp|O83790|TRXB_TREPA | Thioredoxin reductase OS=Treponema pallidum (strain Nichols) GN=trxB PE=3 SV=1 | 20 | 318 | 1.0E-57 |
sp|P50971|TRXB_EUBAC | Thioredoxin reductase OS=Eubacterium acidaminophilum GN=trxB PE=1 SV=1 | 20 | 329 | 1.0E-57 |
sp|Q9ZL18|TRXB_HELPJ | Thioredoxin reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxB PE=3 SV=1 | 22 | 325 | 5.0E-57 |
sp|P56431|TRXB_HELPY | Thioredoxin reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxB PE=1 SV=1 | 22 | 325 | 2.0E-56 |
sp|P23160|R34K_CLOPA | 34.2 kDa protein in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 | 20 | 329 | 2.0E-53 |
sp|O66790|TRXB_AQUAE | Thioredoxin reductase OS=Aquifex aeolicus (strain VF5) GN=trxB PE=3 SV=1 | 20 | 335 | 3.0E-46 |
sp|Q9PR71|TRXB_UREPA | Thioredoxin reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=trxB PE=3 SV=1 | 20 | 329 | 8.0E-41 |
sp|Q98PK9|TRXB_MYCPU | Thioredoxin reductase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=trxB PE=3 SV=1 | 20 | 321 | 4.0E-38 |
sp|P26829|DHNA_BACYN | NADH dehydrogenase OS=Bacillus sp. (strain YN-1) GN=ahpF PE=1 SV=1 | 7 | 323 | 1.0E-37 |
sp|P47348|TRXB_MYCGE | Thioredoxin reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxB PE=3 SV=1 | 20 | 325 | 2.0E-37 |
sp|Q58931|TRXB_METJA | Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 | 21 | 329 | 7.0E-37 |
sp|Q6GC92|AHPF_STAAS | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 | 20 | 314 | 4.0E-34 |
sp|P66013|AHPF_STAAW | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 | 20 | 314 | 5.0E-34 |
sp|P99118|AHPF_STAAN | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 | 20 | 314 | 5.0E-34 |
sp|P66012|AHPF_STAAM | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 | 20 | 314 | 5.0E-34 |
sp|Q5HRY2|AHPF_STAEQ | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpF PE=3 SV=1 | 10 | 314 | 7.0E-34 |
sp|Q8CMQ1|AHPF_STAES | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpF PE=3 SV=1 | 10 | 314 | 7.0E-34 |
sp|Q5HIR6|AHPF_STAAC | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 | 20 | 314 | 1.0E-33 |
sp|O05204|AHPF_STAA8 | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 | 20 | 314 | 1.0E-33 |
sp|P75531|TRXB_MYCPN | Thioredoxin reductase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxB PE=3 SV=1 | 35 | 329 | 1.0E-33 |
sp|Q6GJR8|AHPF_STAAR | Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 | 20 | 314 | 2.0E-33 |
sp|P42974|DHNA_BACSU | NADH dehydrogenase OS=Bacillus subtilis (strain 168) GN=ahpF PE=1 SV=2 | 20 | 323 | 3.0E-33 |
sp|Q9I6Z2|AHPF_PSEAE | Alkyl hydroperoxide reductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ahpF PE=3 SV=1 | 57 | 323 | 4.0E-33 |
sp|P0A156|AHPF_PSEPU | Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida GN=ahpF PE=3 SV=1 | 57 | 323 | 1.0E-32 |
sp|P0A155|AHPF_PSEPK | Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida (strain KT2440) GN=ahpF PE=3 SV=1 | 57 | 323 | 1.0E-32 |
sp|P19480|AHPF_SALTY | Alkyl hydroperoxide reductase subunit F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpF PE=1 SV=1 | 20 | 323 | 5.0E-32 |
sp|P35340|AHPF_ECOLI | Alkyl hydroperoxide reductase subunit F OS=Escherichia coli (strain K12) GN=ahpF PE=1 SV=2 | 11 | 323 | 2.0E-30 |
sp|O06465|AHPF_XANCH | Alkyl hydroperoxide reductase subunit F OS=Xanthomonas campestris pv. phaseoli GN=ahpF PE=3 SV=1 | 57 | 323 | 2.0E-26 |
sp|Q6L1Y6|FENR_PICTO | Ferredoxin--NADP reductase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0431 PE=3 SV=1 | 20 | 303 | 5.0E-23 |
sp|Q4JCM0|FENR1_SULAC | Ferredoxin--NADP reductase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0029 PE=3 SV=1 | 20 | 303 | 6.0E-18 |
sp|Q8DUN5|FENR_STRMU | Ferredoxin--NADP reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_869 PE=3 SV=1 | 13 | 318 | 9.0E-18 |
sp|A4YER6|FENR_METS5 | Ferredoxin--NADP reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_0743 PE=3 SV=2 | 19 | 303 | 9.0E-18 |
sp|Q96YN9|FENR_SULTO | Ferredoxin--NADP reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_21330 PE=3 SV=2 | 20 | 321 | 2.0E-16 |
sp|B4U394|FENR_STREM | Ferredoxin--NADP reductase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=Sez_1109 PE=3 SV=1 | 20 | 318 | 9.0E-16 |
sp|Q8DYW9|FENR_STRA5 | Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1353 PE=3 SV=1 | 20 | 318 | 2.0E-15 |
sp|Q8E4H8|FENR_STRA3 | Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1423 PE=3 SV=1 | 20 | 318 | 2.0E-15 |
sp|Q3K0F9|FENR_STRA1 | Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=SAK_1384 PE=3 SV=1 | 20 | 318 | 2.0E-15 |
sp|A7GKN4|FENR1_BACCN | Ferredoxin--NADP reductase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_0331 PE=3 SV=1 | 20 | 303 | 4.0E-14 |
sp|Q9CF34|FENR_LACLA | Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=LL1647 PE=3 SV=1 | 20 | 318 | 5.0E-14 |
sp|Q02XL9|FENR_LACLS | Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=LACR_1811 PE=3 SV=1 | 20 | 318 | 7.0E-14 |
sp|Q97WJ5|FENR_SULSO | Ferredoxin--NADP reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2222 PE=3 SV=1 | 20 | 303 | 8.0E-14 |
sp|A2RJC6|FENR_LACLM | Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=llmg_0776 PE=3 SV=1 | 20 | 318 | 3.0E-13 |
sp|Q6HP49|FENR1_BACHK | Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_0321 PE=3 SV=1 | 20 | 303 | 4.0E-13 |
sp|Q81ZB7|FENR1_BACAN | Ferredoxin--NADP reductase 1 OS=Bacillus anthracis GN=BA_0352 PE=3 SV=1 | 20 | 303 | 4.0E-13 |
sp|A0R951|FENR1_BACAH | Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_0343 PE=3 SV=1 | 20 | 303 | 4.0E-13 |
sp|A0AL74|FENR2_LISW6 | Ferredoxin--NADP reductase 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe2338 PE=3 SV=1 | 20 | 303 | 5.0E-13 |
sp|Q8Y4P5|FENR2_LISMO | Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2390 PE=3 SV=1 | 20 | 303 | 7.0E-13 |
sp|Q71X35|FENR2_LISMF | Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_2364 PE=3 SV=1 | 20 | 303 | 1.0E-12 |
sp|Q03ZE9|FENR_LEUMM | Ferredoxin--NADP reductase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=LEUM_0297 PE=3 SV=1 | 20 | 318 | 1.0E-12 |
sp|Q4J6Z4|FENR2_SULAC | Ferredoxin--NADP reductase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_2144 PE=3 SV=1 | 57 | 303 | 2.0E-12 |
sp|Q73EA6|FENR1_BACC1 | Ferredoxin--NADP reductase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0452 PE=3 SV=1 | 20 | 303 | 2.0E-12 |
sp|A7Z8C1|FENR2_BACMF | Ferredoxin--NADP reductase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_029160 PE=3 SV=1 | 20 | 318 | 2.0E-12 |
sp|Q928P3|FENR2_LISIN | Ferredoxin--NADP reductase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2489 PE=3 SV=1 | 20 | 303 | 2.0E-12 |
sp|B1MX70|FENR_LEUCK | Ferredoxin--NADP reductase OS=Leuconostoc citreum (strain KM20) GN=LCK_00289 PE=3 SV=2 | 20 | 302 | 3.0E-12 |
sp|Q03JS2|FENR_STRTD | Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=STER_1382 PE=3 SV=1 | 20 | 318 | 3.0E-12 |
sp|Q5M3J6|FENR_STRT2 | Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=stu1417 PE=3 SV=1 | 20 | 318 | 3.0E-12 |
sp|Q5LYY3|FENR_STRT1 | Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=str1417 PE=3 SV=1 | 20 | 318 | 3.0E-12 |
sp|B3CMJ8|FENR_WOLPP | Ferredoxin--NADP reductase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=WP1010 PE=3 SV=1 | 16 | 329 | 4.0E-12 |
sp|O05268|FENR2_BACSU | Ferredoxin--NADP reductase 2 OS=Bacillus subtilis (strain 168) GN=yumC PE=1 SV=2 | 20 | 318 | 5.0E-12 |
sp|Q65GY3|FENR1_BACLD | Ferredoxin--NADP reductase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi02810 PE=3 SV=1 | 20 | 303 | 8.0E-12 |
sp|A9VRK8|FENR1_BACWK | Ferredoxin--NADP reductase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_0332 PE=3 SV=1 | 20 | 303 | 9.0E-12 |
sp|B1I067|FENR2_LYSSC | Ferredoxin--NADP reductase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0993 PE=3 SV=1 | 20 | 331 | 1.0E-11 |
sp|A8FH11|FENR2_BACP2 | Ferredoxin--NADP reductase 2 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_2873 PE=3 SV=1 | 20 | 318 | 1.0E-11 |
sp|B3WCB2|FENR_LACCB | Ferredoxin--NADP reductase OS=Lactobacillus casei (strain BL23) GN=LCABL_08900 PE=3 SV=1 | 19 | 318 | 1.0E-11 |
sp|A8AA47|FENR_IGNH4 | Ferredoxin--NADP reductase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0617 PE=3 SV=1 | 21 | 329 | 1.0E-11 |
sp|Q8DP13|FENR_STRR6 | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr1421 PE=3 SV=1 | 20 | 302 | 2.0E-11 |
sp|Q04JI5|FENR_STRP2 | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=SPD_1393 PE=3 SV=1 | 20 | 302 | 2.0E-11 |
sp|Q03AW0|FENR_LACC3 | Ferredoxin--NADP reductase OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_0826 PE=3 SV=1 | 19 | 318 | 2.0E-11 |
sp|Q73GH2|FENR_WOLPM | Ferredoxin--NADP reductase OS=Wolbachia pipientis wMel GN=WD_0982 PE=3 SV=1 | 16 | 329 | 4.0E-11 |
sp|Q3YS71|FENR_EHRCJ | Ferredoxin--NADP reductase OS=Ehrlichia canis (strain Jake) GN=Ecaj_0391 PE=3 SV=1 | 18 | 335 | 5.0E-11 |
sp|Q74KS6|FENR_LACJO | Ferredoxin--NADP reductase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_0501 PE=3 SV=1 | 20 | 323 | 9.0E-11 |
sp|Q67QU3|FENR_SYMTH | Ferredoxin--NADP reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH965 PE=3 SV=1 | 13 | 303 | 9.0E-11 |
sp|Q72LG3|FENR_THET2 | Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0096 PE=3 SV=1 | 17 | 303 | 1.0E-10 |
sp|Q8ENX4|FENR2_OCEIH | Ferredoxin--NADP reductase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2351 PE=3 SV=1 | 20 | 321 | 1.0E-10 |
sp|A9NFF6|FENR_ACHLI | Ferredoxin--NADP reductase OS=Acholeplasma laidlawii (strain PG-8A) GN=ACL_0467 PE=3 SV=2 | 19 | 321 | 2.0E-10 |
sp|Q65FE0|FENR2_BACLD | Ferredoxin--NADP reductase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi03393 PE=3 SV=1 | 20 | 318 | 2.0E-10 |
sp|A4ISE6|FENR_GEOTN | Ferredoxin--NADP reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_2905 PE=3 SV=1 | 20 | 303 | 2.0E-10 |
sp|B1ICY3|FENR_STRPI | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=SPH_1677 PE=3 SV=1 | 20 | 302 | 3.0E-10 |
sp|Q2W0C9|FENR_MAGSA | Ferredoxin--NADP reductase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=amb3892 PE=3 SV=1 | 18 | 303 | 4.0E-10 |
sp|Q5SL28|FENR_THET8 | Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0465 PE=1 SV=1 | 17 | 303 | 5.0E-10 |
sp|B5E6K6|FENR_STRP4 | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=SPG_1489 PE=3 SV=1 | 20 | 302 | 5.0E-10 |
sp|B1HW35|FENR3_LYSSC | Ferredoxin--NADP reductase 3 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_2322 PE=3 SV=1 | 20 | 303 | 8.0E-10 |
sp|B2IR81|FENR_STRPS | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=SPCG_1548 PE=3 SV=1 | 20 | 302 | 8.0E-10 |
sp|Q97PP0|FENR_STRPN | Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1563 PE=3 SV=1 | 20 | 302 | 8.0E-10 |
sp|Q5KVP7|FENR_GEOKA | Ferredoxin--NADP reductase OS=Geobacillus kaustophilus (strain HTA426) GN=GK2954 PE=3 SV=1 | 20 | 303 | 1.0E-09 |
sp|B2GEF7|FENR_LACF3 | Ferredoxin--NADP reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1703 PE=3 SV=1 | 20 | 302 | 1.0E-09 |
sp|Q5WAF1|FENR1_BACSK | Ferredoxin--NADP reductase 1 OS=Bacillus clausii (strain KSM-K16) GN=ABC0094 PE=3 SV=2 | 20 | 303 | 2.0E-09 |
sp|Q1JHF5|FENR_STRPD | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=MGAS10270_Spy0716 PE=3 SV=1 | 66 | 318 | 2.0E-09 |
sp|B5XKX5|FENR_STRPZ | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=Spy49_0668 PE=3 SV=1 | 66 | 302 | 3.0E-09 |
sp|B1YEQ1|FENR2_EXIS2 | Ferredoxin--NADP reductase 2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2773 PE=3 SV=1 | 20 | 303 | 3.0E-09 |
sp|Q38YJ1|FENR2_LACSS | Ferredoxin--NADP reductase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_0435 PE=3 SV=1 | 20 | 318 | 3.0E-09 |
sp|A2RF47|FENR_STRPG | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM51151 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q1JMB2|FENR_STRPC | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=MGAS9429_Spy0712 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q1JCC9|FENR_STRPB | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=MGAS2096_Spy0727 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q8P1F2|FENR_STRP8 | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_0909 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q5XCQ2|FENR_STRP6 | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0676 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q1J776|FENR_STRPF | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=MGAS10750_Spy0748 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|Q9K7F3|FENR_BACHD | Ferredoxin--NADP reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3408 PE=3 SV=1 | 12 | 303 | 4.0E-09 |
sp|P0DB07|FENR_STRPQ | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1279 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|P0DB06|FENR_STRP3 | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0575 PE=3 SV=1 | 66 | 302 | 4.0E-09 |
sp|A3CM39|FENR_STRSV | Ferredoxin--NADP reductase OS=Streptococcus sanguinis (strain SK36) GN=SSA_0813 PE=3 SV=1 | 20 | 302 | 4.0E-09 |
sp|Q2GGH5|FENR_EHRCR | Ferredoxin--NADP reductase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ECH_0649 PE=3 SV=1 | 18 | 335 | 5.0E-09 |
sp|Q9A0B5|FENR_STRP1 | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M1 GN=SPy_0850 PE=3 SV=1 | 66 | 302 | 5.0E-09 |
sp|Q48U54|FENR_STRPM | Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=M28_Spy0638 PE=3 SV=1 | 66 | 302 | 6.0E-09 |
sp|Q8U195|SUDHA_PYRFU | Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 | 14 | 333 | 7.0E-09 |
sp|Q816D9|FENR_BACCR | Ferredoxin--NADP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_4926 PE=3 SV=1 | 20 | 318 | 9.0E-09 |
sp|Q632D6|FENR_BACCZ | Ferredoxin--NADP reductase OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L4658 PE=3 SV=1 | 20 | 318 | 1.0E-08 |
sp|Q6HBX6|FENR2_BACHK | Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_4639 PE=3 SV=1 | 20 | 318 | 1.0E-08 |
sp|Q72YF6|FENR2_BACC1 | Ferredoxin--NADP reductase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_5065 PE=3 SV=1 | 20 | 318 | 1.0E-08 |
sp|Q81XS0|FENR2_BACAN | Ferredoxin--NADP reductase 2 OS=Bacillus anthracis GN=BA_5160 PE=3 SV=1 | 20 | 318 | 1.0E-08 |
sp|A0RKB9|FENR2_BACAH | Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_4465 PE=3 SV=1 | 20 | 318 | 1.0E-08 |
sp|Q5HBC7|FENR_EHRRW | Ferredoxin--NADP reductase OS=Ehrlichia ruminantium (strain Welgevonden) GN=Erum4020 PE=3 SV=1 | 18 | 335 | 1.0E-08 |
sp|P80892|TRXB_ALIFS | Thioredoxin reductase (Fragment) OS=Aliivibrio fischeri GN=trxB PE=1 SV=1 | 17 | 61 | 1.0E-08 |
sp|A8AXQ6|FENR_STRGC | Ferredoxin--NADP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=SGO_1284 PE=3 SV=1 | 20 | 302 | 1.0E-08 |
sp|B2G9D0|FENR_LACRJ | Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain JCM 1112) GN=LAR_1546 PE=3 SV=1 | 20 | 318 | 3.0E-08 |
sp|A5VM22|FENR_LACRD | Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain DSM 20016) GN=Lreu_1657 PE=3 SV=1 | 20 | 318 | 3.0E-08 |
sp|A0LY71|FENR2_GRAFK | Ferredoxin--NADP reductase 2 OS=Gramella forsetii (strain KT0803) GN=GFO_0330 PE=3 SV=1 | 16 | 316 | 4.0E-08 |
sp|A8YTT2|FENR_LACH4 | Ferredoxin--NADP reductase OS=Lactobacillus helveticus (strain DPC 4571) GN=lhv_0465 PE=3 SV=2 | 22 | 318 | 4.0E-08 |
sp|Q4L8N5|FENR_STAHJ | Ferredoxin--NADP reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0681 PE=3 SV=1 | 20 | 303 | 5.0E-08 |
sp|A9VMZ3|FENR2_BACWK | Ferredoxin--NADP reductase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_4748 PE=3 SV=1 | 20 | 318 | 5.0E-08 |
sp|B1YKW2|FENR1_EXIS2 | Ferredoxin--NADP reductase 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2313 PE=3 SV=1 | 20 | 329 | 8.0E-08 |
sp|Q5FH31|FENR_EHRRG | Ferredoxin--NADP reductase OS=Ehrlichia ruminantium (strain Gardel) GN=ERGA_CDS_04100 PE=3 SV=1 | 18 | 335 | 8.0E-08 |
sp|Q7NBE9|FENR_MYCGA | Ferredoxin--NADP reductase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=MYCGA3300 PE=3 SV=1 | 20 | 301 | 9.0E-08 |
sp|Q88UC0|FENR_LACPL | Ferredoxin--NADP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2585 PE=3 SV=1 | 20 | 318 | 1.0E-07 |
sp|B3CTT3|FENR_ORITI | Ferredoxin--NADP reductase OS=Orientia tsutsugamushi (strain Ikeda) GN=OTT_1322 PE=3 SV=1 | 13 | 303 | 1.0E-07 |
sp|Q8EWR4|FENR_MYCPE | Ferredoxin--NADP reductase OS=Mycoplasma penetrans (strain HF-2) GN=MYPE1390 PE=3 SV=1 | 165 | 302 | 1.0E-07 |
sp|P85207|DLDH_THESS | Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 | 20 | 303 | 2.0E-07 |
sp|B1HZ05|FENR1_LYSSC | Ferredoxin--NADP reductase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0789 PE=3 SV=2 | 20 | 303 | 2.0E-07 |
sp|A7GUD5|FENR2_BACCN | Ferredoxin--NADP reductase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_3539 PE=3 SV=1 | 20 | 318 | 2.0E-07 |
sp|A0AK73|FENR1_LISW6 | Ferredoxin--NADP reductase 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe1987 PE=3 SV=1 | 20 | 316 | 6.0E-07 |
sp|Q2GCZ2|FENR_NEOSM | Ferredoxin--NADP reductase OS=Neorickettsia sennetsu (strain Miyayama) GN=NSE_0779 PE=3 SV=1 | 16 | 303 | 7.0E-07 |
sp|Q0BQJ9|FENR_GRABC | Ferredoxin--NADP reductase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_2006 PE=3 SV=2 | 6 | 335 | 1.0E-06 |
sp|A0LXL9|FENR1_GRAFK | Ferredoxin--NADP reductase 1 OS=Gramella forsetii (strain KT0803) GN=GFO_0125 PE=3 SV=1 | 16 | 316 | 2.0E-06 |
sp|Q1WUT6|FENR_LACS1 | Ferredoxin--NADP reductase OS=Lactobacillus salivarius (strain UCC118) GN=LSL_0439 PE=3 SV=1 | 165 | 318 | 2.0E-06 |
sp|B2IHR5|FENR_BEII9 | Ferredoxin--NADP reductase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_2345 PE=3 SV=1 | 18 | 335 | 2.0E-06 |
sp|Q473F6|FENR1_CUPPJ | Ferredoxin--NADP reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A1099 PE=3 SV=1 | 18 | 316 | 2.0E-06 |
sp|B4SFQ3|FENR_PELPB | Ferredoxin--NADP reductase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=Ppha_1024 PE=3 SV=1 | 20 | 303 | 2.0E-06 |
sp|B3EKW5|FENR_CHLPB | Ferredoxin--NADP reductase OS=Chlorobium phaeobacteroides (strain BS1) GN=Cphamn1_1733 PE=3 SV=1 | 20 | 303 | 2.0E-06 |
sp|A4VXW3|FENR_STRSY | Ferredoxin--NADP reductase OS=Streptococcus suis (strain 05ZYH33) GN=SSU05_1986 PE=3 SV=1 | 20 | 302 | 2.0E-06 |
sp|A4W460|FENR_STRS2 | Ferredoxin--NADP reductase OS=Streptococcus suis (strain 98HAH33) GN=SSU98_1991 PE=3 SV=2 | 20 | 302 | 2.0E-06 |
sp|Q5FT88|FENR_GLUOX | Ferredoxin--NADP reductase OS=Gluconobacter oxydans (strain 621H) GN=GOX0631 PE=3 SV=2 | 14 | 303 | 2.0E-06 |
sp|Q04HB6|FENR_OENOB | Ferredoxin--NADP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0163 PE=3 SV=1 | 20 | 302 | 2.0E-06 |
sp|A5FYH8|FENR_ACICJ | Ferredoxin--NADP reductase OS=Acidiphilium cryptum (strain JF-5) GN=Acry_1452 PE=3 SV=1 | 13 | 335 | 3.0E-06 |
sp|Q49ZU9|FENR_STAS1 | Ferredoxin--NADP reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0530 PE=3 SV=1 | 20 | 303 | 5.0E-06 |
sp|Q5FLU4|FENR_LACAC | Ferredoxin--NADP reductase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=LBA0439 PE=3 SV=2 | 29 | 318 | 6.0E-06 |
sp|B3QXE1|FENR1_CHLT3 | Ferredoxin--NADP reductase 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=Ctha_0950 PE=3 SV=1 | 20 | 303 | 6.0E-06 |
sp|Q1LPH7|FENR1_CUPMC | Ferredoxin--NADP reductase 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_1063 PE=3 SV=1 | 17 | 316 | 7.0E-06 |
sp|Q219B6|FENR_RHOPB | Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_1458 PE=3 SV=1 | 13 | 304 | 7.0E-06 |
sp|Q92A47|FENR1_LISIN | Ferredoxin--NADP reductase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2075 PE=3 SV=1 | 20 | 316 | 8.0E-06 |
sp|Q96NN9|AIFM3_HUMAN | Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 | 92 | 302 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016491 | oxidoreductase activity | Yes |
GO:0003824 | catalytic activity | No |
GO:0003674 | molecular_function | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 33 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|099540 MPVVIPPRKNERSKKLHSKVVIIGSGPAGHTAAIYLARANLSPLMFEGFMANGFAAGGQLTTTTDVENFPGFPTG ILGPELMEKFREQSIRFGTRIITETVSKIDLSSRPFRYWREMQEGDEPETADTIIIATGASAKRLGLKGEQTYWQ SGISACAVCDGAVPIFRNKPLAVIGGGDSAAEEATYLTKYGSHVYVLVRRAELRASKIMANRVLKNPKITVLWNT VAVECQGDGDLLNNLRIKNVQTGEERDLAVNGLFYAIGHEPATAIVRSQLQTDPDGYIITVPGTTETSVKGVFAA GDVQDKRYRQAITSAGSGCMAALEVEKLIAEEEELGEIDM* |
Coding | >AgabiH97|099540 ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTGATCATTGGATCA GGTCCTGCTGGACATACCGCTGCTATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATG GCCAATGGATTCGCCGCTGGTGGCCAACTTACTACTACCACTGATGTCGAGAACTTCCCGGGCTTTCCTACTGGC ATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGAACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACA GTATCGAAAATAGATCTATCTTCACGTCCTTTCAGATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACT GCTGATACTATTATCATTGCTACTGGTGCTAGTGCAAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAG AGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGCTGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGT GGTGGTGATTCTGCTGCGGAAGAAGCTACATATTTGACCAAGTATGGGTCACATGTGTATGTCCTAGTCCGACGT GCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAACTGTGCTTTGGAACACC GTAGCTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAG CGTGACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTC CAAACTGACCCTGATGGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCG GGTGATGTACAAGATAAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTT GAGAAGCTCATTGCGGAGGAAGAGGAGCTCGGTGAGATCGACATGTAA |
Transcript | >AgabiH97|099540 ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTGATCATTGGATCA GGTCCTGCTGGACATACCGCTGCTATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATG GCCAATGGATTCGCCGCTGGTGGCCAACTTACTACTACCACTGATGTCGAGAACTTCCCGGGCTTTCCTACTGGC ATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGAACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACA GTATCGAAAATAGATCTATCTTCACGTCCTTTCAGATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACT GCTGATACTATTATCATTGCTACTGGTGCTAGTGCAAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAG AGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGCTGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGT GGTGGTGATTCTGCTGCGGAAGAAGCTACATATTTGACCAAGTATGGGTCACATGTGTATGTCCTAGTCCGACGT GCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAACTGTGCTTTGGAACACC GTAGCTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAG CGTGACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTC CAAACTGACCCTGATGGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCG GGTGATGTACAAGATAAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTT GAGAAGCTCATTGCGGAGGAAGAGGAGCTCGGTGAGATCGACATGTAA |
Gene | >AgabiH97|099540 ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTATGTCTTGTTTTT TTCTTTGAACTGATGAAGCGCTTATGATTATCGTAGGTGATCATTGGATCAGGTCCTGCTGGACATACCGCTGCT ATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATGGCCAATGGATTCGCCGCTGGTGGC CAACTTACTACTACCACTGATGGTAAATATCCACTTCATCTTTACGAGCGACTTCCCGTCACTAATAACGATGTG CATTTTTCTAGTCGAGAACTTCCCGGGCTTTCCTACTGGCATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGA ACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACAGTATCGAAAATAGATCTATCTTCACGTCCTTTCAG ATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACTGCTGATACTATTATCATTGCTACTGGTGCTAGTGC AAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAGAGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGC TGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGTGGTGGTGATTCTGCTGCGGAAGAAGCTACATGTAC GTTGGGGTTTTTCGTCGTTTCCTCGAGTAATATGCTGAGGATCGATAGATTTGACCAAGTATGGGTCACATGTGT ATGTCCTAGTCCGACGTGCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAG TGGGTTCTCAACATCGCGCCAACTCGAAAGTTCATTGATGCAAATATTAATAGACTGTGCTTTGGAACACCGTAG CTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAGCGTG ACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTACGTCTTCTAAGTGCACTTCATCTGGCCTTGGGCAGTATG GTTGATCTCATCGACCCTTCAGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTCCAAACTGACCCTGAT GGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCGGGTGATGTACAAGAT AAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTTGAGAAGCTCATTGCG GAGGAAGAGGAGCTCGGTGAGATCGACATGTAA |