Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099540
Gene name
Locationscaffold_7:661671..662979
Strand-
Gene length (bp)1308
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 5.3E-44 19 314
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 5.1E-14 125 301
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.1E-14 171 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 17 333 7.0E-176
sp|Q92375|TRXB_SCHPO Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 17 334 5.0E-167
sp|Q6FR39|TRXB_CANGA Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 17 333 3.0E-166
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 16 334 1.0E-165
sp|Q6HA24|TRXB_KLULA Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 14 333 3.0E-165
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 17 333 7.0E-176
sp|Q92375|TRXB_SCHPO Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 17 334 5.0E-167
sp|Q6FR39|TRXB_CANGA Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 17 333 3.0E-166
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 16 334 1.0E-165
sp|Q6HA24|TRXB_KLULA Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 14 333 3.0E-165
sp|Q6BIS1|TRXB_DEBHA Thioredoxin reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRR1 PE=3 SV=1 16 333 2.0E-164
sp|P29509|TRXB1_YEAST Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3 16 333 7.0E-164
sp|P38816|TRXB2_YEAST Thioredoxin reductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR2 PE=1 SV=1 9 333 4.0E-163
sp|Q75CM8|TRXB_ASHGO Thioredoxin reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRR1 PE=3 SV=2 16 333 5.0E-162
sp|Q8J0U0|TRXB_PNEJI Thioredoxin reductase OS=Pneumocystis jiroveci GN=TRR1 PE=2 SV=1 16 321 2.0E-155
sp|P43496|TRXB_PENCH Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 16 333 6.0E-154
sp|Q7Z7S3|TRXB_PNECA Thioredoxin reductase OS=Pneumocystis carinii GN=TRR1 PE=2 SV=1 16 321 5.0E-153
sp|Q39242|TRXB2_ARATH Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2 18 331 5.0E-142
sp|Q54UU8|TRXB_DICDI Thioredoxin reductase OS=Dictyostelium discoideum GN=trrA PE=3 SV=1 19 330 7.0E-135
sp|Q39243|TRXB1_ARATH Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=3 17 331 1.0E-134
sp|Q69PS6|NTRA_ORYSJ Thioredoxin reductase NTRA OS=Oryza sativa subsp. japonica GN=Os06g0327300 PE=3 SV=2 16 331 2.0E-132
sp|Q6ZFU6|NTRB_ORYSJ Thioredoxin reductase NTRB OS=Oryza sativa subsp. japonica GN=NTRB PE=2 SV=1 16 331 2.0E-132
sp|Q9Z8M4|TRXB_CHLPN Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1 16 329 1.0E-122
sp|O84101|TRXB_CHLTR Thioredoxin reductase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxB PE=3 SV=2 17 329 7.0E-117
sp|Q9PKT7|TRXB_CHLMU Thioredoxin reductase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxB PE=3 SV=1 17 329 9.0E-117
sp|Q70G58|NTRC_ORYSJ Thioredoxin reductase NTRC OS=Oryza sativa subsp. japonica GN=Os07g0657900 PE=1 SV=2 20 338 2.0E-111
sp|O22229|TRXB3_ARATH NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana GN=NTRC PE=1 SV=2 20 338 7.0E-110
sp|Q1RJD8|TRXB_RICBR Thioredoxin reductase OS=Rickettsia bellii (strain RML369-C) GN=trxB PE=3 SV=1 15 329 2.0E-104
sp|Q4ULP1|TRXB_RICFE Thioredoxin reductase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxB PE=3 SV=1 15 329 8.0E-102
sp|Q68WT3|TRXB_RICTY Thioredoxin reductase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxB PE=3 SV=1 15 329 2.0E-100
sp|Q9ZD97|TRXB_RICPR Thioredoxin reductase OS=Rickettsia prowazekii (strain Madrid E) GN=trxB PE=3 SV=1 15 329 6.0E-100
sp|Q92I02|TRXB_RICCN Thioredoxin reductase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxB PE=3 SV=1 15 329 1.0E-99
sp|P9WHH1|TRXB_MYCTU Thioredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxB PE=1 SV=1 7 339 2.0E-97
sp|P9WHH0|TRXB_MYCTO Thioredoxin reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxB PE=3 SV=1 7 339 2.0E-97
sp|O30973|TRXB_MYCSM Thioredoxin reductase OS=Mycobacterium smegmatis GN=trxB PE=3 SV=1 13 333 1.0E-93
sp|P52215|TRXB_STRCO Thioredoxin reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxB PE=2 SV=3 19 330 2.0E-92
sp|Q9KSS4|TRXB_VIBCH Thioredoxin reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trxB PE=3 SV=1 17 329 4.0E-92
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 19 339 7.0E-91
sp|P39916|TRXB_COXBU Thioredoxin reductase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=trxB PE=3 SV=2 13 329 1.0E-90
sp|P43788|TRXB_HAEIN Thioredoxin reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxB PE=3 SV=1 17 333 2.0E-90
sp|P0A9P4|TRXB_ECOLI Thioredoxin reductase OS=Escherichia coli (strain K12) GN=trxB PE=1 SV=2 17 329 2.0E-89
sp|P0A9P5|TRXB_ECO57 Thioredoxin reductase OS=Escherichia coli O157:H7 GN=trxB PE=3 SV=2 17 329 2.0E-89
sp|Q05741|TRXB_STRC2 Thioredoxin reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxB PE=1 SV=3 19 337 6.0E-89
sp|Q93HX6|GLCAL_PSEFL Glucosaminate ammonia-lyase OS=Pseudomonas fluorescens PE=1 SV=2 17 329 4.0E-86
sp|Q8T6Z1|TRXB_SPIBA Thioredoxin reductase (Fragment) OS=Spironucleus barkhanus GN=TRXB PE=2 SV=1 20 330 6.0E-79
sp|P81433|TRXB_BUCAP Thioredoxin reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxB PE=3 SV=1 15 329 3.0E-77
sp|Q89AJ2|TRXB_BUCBP Thioredoxin reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxB PE=3 SV=1 17 332 2.0E-72
sp|P57399|TRXB_BUCAI Thioredoxin reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxB PE=3 SV=1 17 329 2.0E-72
sp|P80880|TRXB_BACSU Thioredoxin reductase OS=Bacillus subtilis (strain 168) GN=trxB PE=1 SV=3 20 334 2.0E-68
sp|O32823|TRXB_LISMO Thioredoxin reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxB PE=3 SV=1 20 334 2.0E-66
sp|Q928B5|TRXB_LISIN Thioredoxin reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxB PE=3 SV=1 20 329 2.0E-66
sp|Q8CPY8|TRXB_STAES Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 20 331 4.0E-66
sp|Q5HQW4|TRXB_STAEQ Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 20 331 4.0E-66
sp|P94284|TRXB_BORBU Thioredoxin reductase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxB PE=3 SV=2 5 325 6.0E-66
sp|P66011|TRXB_STAAW Thioredoxin reductase OS=Staphylococcus aureus (strain MW2) GN=trxB PE=1 SV=1 20 329 2.0E-65
sp|Q6GB66|TRXB_STAAS Thioredoxin reductase OS=Staphylococcus aureus (strain MSSA476) GN=trxB PE=3 SV=1 20 329 2.0E-65
sp|P99101|TRXB_STAAN Thioredoxin reductase OS=Staphylococcus aureus (strain N315) GN=trxB PE=1 SV=1 20 329 2.0E-65
sp|P66010|TRXB_STAAM Thioredoxin reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxB PE=3 SV=1 20 329 2.0E-65
sp|Q5HHQ4|TRXB_STAAC Thioredoxin reductase OS=Staphylococcus aureus (strain COL) GN=trxB PE=3 SV=1 20 329 2.0E-65
sp|Q6GIM7|TRXB_STAAR Thioredoxin reductase OS=Staphylococcus aureus (strain MRSA252) GN=trxB PE=3 SV=1 20 329 9.0E-65
sp|P52213|TRXB_CLOLI Thioredoxin reductase OS=Clostridium litorale GN=trxB PE=3 SV=1 20 331 5.0E-59
sp|O83790|TRXB_TREPA Thioredoxin reductase OS=Treponema pallidum (strain Nichols) GN=trxB PE=3 SV=1 20 318 1.0E-57
sp|P50971|TRXB_EUBAC Thioredoxin reductase OS=Eubacterium acidaminophilum GN=trxB PE=1 SV=1 20 329 1.0E-57
sp|Q9ZL18|TRXB_HELPJ Thioredoxin reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxB PE=3 SV=1 22 325 5.0E-57
sp|P56431|TRXB_HELPY Thioredoxin reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxB PE=1 SV=1 22 325 2.0E-56
sp|P23160|R34K_CLOPA 34.2 kDa protein in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 20 329 2.0E-53
sp|O66790|TRXB_AQUAE Thioredoxin reductase OS=Aquifex aeolicus (strain VF5) GN=trxB PE=3 SV=1 20 335 3.0E-46
sp|Q9PR71|TRXB_UREPA Thioredoxin reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=trxB PE=3 SV=1 20 329 8.0E-41
sp|Q98PK9|TRXB_MYCPU Thioredoxin reductase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=trxB PE=3 SV=1 20 321 4.0E-38
sp|P26829|DHNA_BACYN NADH dehydrogenase OS=Bacillus sp. (strain YN-1) GN=ahpF PE=1 SV=1 7 323 1.0E-37
sp|P47348|TRXB_MYCGE Thioredoxin reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxB PE=3 SV=1 20 325 2.0E-37
sp|Q58931|TRXB_METJA Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 21 329 7.0E-37
sp|Q6GC92|AHPF_STAAS Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 20 314 4.0E-34
sp|P66013|AHPF_STAAW Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 20 314 5.0E-34
sp|P99118|AHPF_STAAN Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 20 314 5.0E-34
sp|P66012|AHPF_STAAM Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 20 314 5.0E-34
sp|Q5HRY2|AHPF_STAEQ Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpF PE=3 SV=1 10 314 7.0E-34
sp|Q8CMQ1|AHPF_STAES Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpF PE=3 SV=1 10 314 7.0E-34
sp|Q5HIR6|AHPF_STAAC Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 20 314 1.0E-33
sp|O05204|AHPF_STAA8 Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 20 314 1.0E-33
sp|P75531|TRXB_MYCPN Thioredoxin reductase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxB PE=3 SV=1 35 329 1.0E-33
sp|Q6GJR8|AHPF_STAAR Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 20 314 2.0E-33
sp|P42974|DHNA_BACSU NADH dehydrogenase OS=Bacillus subtilis (strain 168) GN=ahpF PE=1 SV=2 20 323 3.0E-33
sp|Q9I6Z2|AHPF_PSEAE Alkyl hydroperoxide reductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ahpF PE=3 SV=1 57 323 4.0E-33
sp|P0A156|AHPF_PSEPU Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida GN=ahpF PE=3 SV=1 57 323 1.0E-32
sp|P0A155|AHPF_PSEPK Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida (strain KT2440) GN=ahpF PE=3 SV=1 57 323 1.0E-32
sp|P19480|AHPF_SALTY Alkyl hydroperoxide reductase subunit F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpF PE=1 SV=1 20 323 5.0E-32
sp|P35340|AHPF_ECOLI Alkyl hydroperoxide reductase subunit F OS=Escherichia coli (strain K12) GN=ahpF PE=1 SV=2 11 323 2.0E-30
sp|O06465|AHPF_XANCH Alkyl hydroperoxide reductase subunit F OS=Xanthomonas campestris pv. phaseoli GN=ahpF PE=3 SV=1 57 323 2.0E-26
sp|Q6L1Y6|FENR_PICTO Ferredoxin--NADP reductase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0431 PE=3 SV=1 20 303 5.0E-23
sp|Q4JCM0|FENR1_SULAC Ferredoxin--NADP reductase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0029 PE=3 SV=1 20 303 6.0E-18
sp|Q8DUN5|FENR_STRMU Ferredoxin--NADP reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_869 PE=3 SV=1 13 318 9.0E-18
sp|A4YER6|FENR_METS5 Ferredoxin--NADP reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_0743 PE=3 SV=2 19 303 9.0E-18
sp|Q96YN9|FENR_SULTO Ferredoxin--NADP reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_21330 PE=3 SV=2 20 321 2.0E-16
sp|B4U394|FENR_STREM Ferredoxin--NADP reductase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=Sez_1109 PE=3 SV=1 20 318 9.0E-16
sp|Q8DYW9|FENR_STRA5 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1353 PE=3 SV=1 20 318 2.0E-15
sp|Q8E4H8|FENR_STRA3 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1423 PE=3 SV=1 20 318 2.0E-15
sp|Q3K0F9|FENR_STRA1 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=SAK_1384 PE=3 SV=1 20 318 2.0E-15
sp|A7GKN4|FENR1_BACCN Ferredoxin--NADP reductase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_0331 PE=3 SV=1 20 303 4.0E-14
sp|Q9CF34|FENR_LACLA Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=LL1647 PE=3 SV=1 20 318 5.0E-14
sp|Q02XL9|FENR_LACLS Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=LACR_1811 PE=3 SV=1 20 318 7.0E-14
sp|Q97WJ5|FENR_SULSO Ferredoxin--NADP reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2222 PE=3 SV=1 20 303 8.0E-14
sp|A2RJC6|FENR_LACLM Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=llmg_0776 PE=3 SV=1 20 318 3.0E-13
sp|Q6HP49|FENR1_BACHK Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_0321 PE=3 SV=1 20 303 4.0E-13
sp|Q81ZB7|FENR1_BACAN Ferredoxin--NADP reductase 1 OS=Bacillus anthracis GN=BA_0352 PE=3 SV=1 20 303 4.0E-13
sp|A0R951|FENR1_BACAH Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_0343 PE=3 SV=1 20 303 4.0E-13
sp|A0AL74|FENR2_LISW6 Ferredoxin--NADP reductase 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe2338 PE=3 SV=1 20 303 5.0E-13
sp|Q8Y4P5|FENR2_LISMO Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2390 PE=3 SV=1 20 303 7.0E-13
sp|Q71X35|FENR2_LISMF Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_2364 PE=3 SV=1 20 303 1.0E-12
sp|Q03ZE9|FENR_LEUMM Ferredoxin--NADP reductase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=LEUM_0297 PE=3 SV=1 20 318 1.0E-12
sp|Q4J6Z4|FENR2_SULAC Ferredoxin--NADP reductase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_2144 PE=3 SV=1 57 303 2.0E-12
sp|Q73EA6|FENR1_BACC1 Ferredoxin--NADP reductase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0452 PE=3 SV=1 20 303 2.0E-12
sp|A7Z8C1|FENR2_BACMF Ferredoxin--NADP reductase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_029160 PE=3 SV=1 20 318 2.0E-12
sp|Q928P3|FENR2_LISIN Ferredoxin--NADP reductase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2489 PE=3 SV=1 20 303 2.0E-12
sp|B1MX70|FENR_LEUCK Ferredoxin--NADP reductase OS=Leuconostoc citreum (strain KM20) GN=LCK_00289 PE=3 SV=2 20 302 3.0E-12
sp|Q03JS2|FENR_STRTD Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=STER_1382 PE=3 SV=1 20 318 3.0E-12
sp|Q5M3J6|FENR_STRT2 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=stu1417 PE=3 SV=1 20 318 3.0E-12
sp|Q5LYY3|FENR_STRT1 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=str1417 PE=3 SV=1 20 318 3.0E-12
sp|B3CMJ8|FENR_WOLPP Ferredoxin--NADP reductase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=WP1010 PE=3 SV=1 16 329 4.0E-12
sp|O05268|FENR2_BACSU Ferredoxin--NADP reductase 2 OS=Bacillus subtilis (strain 168) GN=yumC PE=1 SV=2 20 318 5.0E-12
sp|Q65GY3|FENR1_BACLD Ferredoxin--NADP reductase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi02810 PE=3 SV=1 20 303 8.0E-12
sp|A9VRK8|FENR1_BACWK Ferredoxin--NADP reductase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_0332 PE=3 SV=1 20 303 9.0E-12
sp|B1I067|FENR2_LYSSC Ferredoxin--NADP reductase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0993 PE=3 SV=1 20 331 1.0E-11
sp|A8FH11|FENR2_BACP2 Ferredoxin--NADP reductase 2 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_2873 PE=3 SV=1 20 318 1.0E-11
sp|B3WCB2|FENR_LACCB Ferredoxin--NADP reductase OS=Lactobacillus casei (strain BL23) GN=LCABL_08900 PE=3 SV=1 19 318 1.0E-11
sp|A8AA47|FENR_IGNH4 Ferredoxin--NADP reductase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0617 PE=3 SV=1 21 329 1.0E-11
sp|Q8DP13|FENR_STRR6 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr1421 PE=3 SV=1 20 302 2.0E-11
sp|Q04JI5|FENR_STRP2 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=SPD_1393 PE=3 SV=1 20 302 2.0E-11
sp|Q03AW0|FENR_LACC3 Ferredoxin--NADP reductase OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_0826 PE=3 SV=1 19 318 2.0E-11
sp|Q73GH2|FENR_WOLPM Ferredoxin--NADP reductase OS=Wolbachia pipientis wMel GN=WD_0982 PE=3 SV=1 16 329 4.0E-11
sp|Q3YS71|FENR_EHRCJ Ferredoxin--NADP reductase OS=Ehrlichia canis (strain Jake) GN=Ecaj_0391 PE=3 SV=1 18 335 5.0E-11
sp|Q74KS6|FENR_LACJO Ferredoxin--NADP reductase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_0501 PE=3 SV=1 20 323 9.0E-11
sp|Q67QU3|FENR_SYMTH Ferredoxin--NADP reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH965 PE=3 SV=1 13 303 9.0E-11
sp|Q72LG3|FENR_THET2 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0096 PE=3 SV=1 17 303 1.0E-10
sp|Q8ENX4|FENR2_OCEIH Ferredoxin--NADP reductase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2351 PE=3 SV=1 20 321 1.0E-10
sp|A9NFF6|FENR_ACHLI Ferredoxin--NADP reductase OS=Acholeplasma laidlawii (strain PG-8A) GN=ACL_0467 PE=3 SV=2 19 321 2.0E-10
sp|Q65FE0|FENR2_BACLD Ferredoxin--NADP reductase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi03393 PE=3 SV=1 20 318 2.0E-10
sp|A4ISE6|FENR_GEOTN Ferredoxin--NADP reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_2905 PE=3 SV=1 20 303 2.0E-10
sp|B1ICY3|FENR_STRPI Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=SPH_1677 PE=3 SV=1 20 302 3.0E-10
sp|Q2W0C9|FENR_MAGSA Ferredoxin--NADP reductase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=amb3892 PE=3 SV=1 18 303 4.0E-10
sp|Q5SL28|FENR_THET8 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0465 PE=1 SV=1 17 303 5.0E-10
sp|B5E6K6|FENR_STRP4 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=SPG_1489 PE=3 SV=1 20 302 5.0E-10
sp|B1HW35|FENR3_LYSSC Ferredoxin--NADP reductase 3 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_2322 PE=3 SV=1 20 303 8.0E-10
sp|B2IR81|FENR_STRPS Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=SPCG_1548 PE=3 SV=1 20 302 8.0E-10
sp|Q97PP0|FENR_STRPN Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1563 PE=3 SV=1 20 302 8.0E-10
sp|Q5KVP7|FENR_GEOKA Ferredoxin--NADP reductase OS=Geobacillus kaustophilus (strain HTA426) GN=GK2954 PE=3 SV=1 20 303 1.0E-09
sp|B2GEF7|FENR_LACF3 Ferredoxin--NADP reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1703 PE=3 SV=1 20 302 1.0E-09
sp|Q5WAF1|FENR1_BACSK Ferredoxin--NADP reductase 1 OS=Bacillus clausii (strain KSM-K16) GN=ABC0094 PE=3 SV=2 20 303 2.0E-09
sp|Q1JHF5|FENR_STRPD Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=MGAS10270_Spy0716 PE=3 SV=1 66 318 2.0E-09
sp|B5XKX5|FENR_STRPZ Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=Spy49_0668 PE=3 SV=1 66 302 3.0E-09
sp|B1YEQ1|FENR2_EXIS2 Ferredoxin--NADP reductase 2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2773 PE=3 SV=1 20 303 3.0E-09
sp|Q38YJ1|FENR2_LACSS Ferredoxin--NADP reductase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_0435 PE=3 SV=1 20 318 3.0E-09
sp|A2RF47|FENR_STRPG Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM51151 PE=3 SV=1 66 302 4.0E-09
sp|Q1JMB2|FENR_STRPC Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=MGAS9429_Spy0712 PE=3 SV=1 66 302 4.0E-09
sp|Q1JCC9|FENR_STRPB Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=MGAS2096_Spy0727 PE=3 SV=1 66 302 4.0E-09
sp|Q8P1F2|FENR_STRP8 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_0909 PE=3 SV=1 66 302 4.0E-09
sp|Q5XCQ2|FENR_STRP6 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0676 PE=3 SV=1 66 302 4.0E-09
sp|Q1J776|FENR_STRPF Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=MGAS10750_Spy0748 PE=3 SV=1 66 302 4.0E-09
sp|Q9K7F3|FENR_BACHD Ferredoxin--NADP reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3408 PE=3 SV=1 12 303 4.0E-09
sp|P0DB07|FENR_STRPQ Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1279 PE=3 SV=1 66 302 4.0E-09
sp|P0DB06|FENR_STRP3 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0575 PE=3 SV=1 66 302 4.0E-09
sp|A3CM39|FENR_STRSV Ferredoxin--NADP reductase OS=Streptococcus sanguinis (strain SK36) GN=SSA_0813 PE=3 SV=1 20 302 4.0E-09
sp|Q2GGH5|FENR_EHRCR Ferredoxin--NADP reductase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ECH_0649 PE=3 SV=1 18 335 5.0E-09
sp|Q9A0B5|FENR_STRP1 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M1 GN=SPy_0850 PE=3 SV=1 66 302 5.0E-09
sp|Q48U54|FENR_STRPM Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=M28_Spy0638 PE=3 SV=1 66 302 6.0E-09
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 14 333 7.0E-09
sp|Q816D9|FENR_BACCR Ferredoxin--NADP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_4926 PE=3 SV=1 20 318 9.0E-09
sp|Q632D6|FENR_BACCZ Ferredoxin--NADP reductase OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L4658 PE=3 SV=1 20 318 1.0E-08
sp|Q6HBX6|FENR2_BACHK Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_4639 PE=3 SV=1 20 318 1.0E-08
sp|Q72YF6|FENR2_BACC1 Ferredoxin--NADP reductase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_5065 PE=3 SV=1 20 318 1.0E-08
sp|Q81XS0|FENR2_BACAN Ferredoxin--NADP reductase 2 OS=Bacillus anthracis GN=BA_5160 PE=3 SV=1 20 318 1.0E-08
sp|A0RKB9|FENR2_BACAH Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_4465 PE=3 SV=1 20 318 1.0E-08
sp|Q5HBC7|FENR_EHRRW Ferredoxin--NADP reductase OS=Ehrlichia ruminantium (strain Welgevonden) GN=Erum4020 PE=3 SV=1 18 335 1.0E-08
sp|P80892|TRXB_ALIFS Thioredoxin reductase (Fragment) OS=Aliivibrio fischeri GN=trxB PE=1 SV=1 17 61 1.0E-08
sp|A8AXQ6|FENR_STRGC Ferredoxin--NADP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=SGO_1284 PE=3 SV=1 20 302 1.0E-08
sp|B2G9D0|FENR_LACRJ Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain JCM 1112) GN=LAR_1546 PE=3 SV=1 20 318 3.0E-08
sp|A5VM22|FENR_LACRD Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain DSM 20016) GN=Lreu_1657 PE=3 SV=1 20 318 3.0E-08
sp|A0LY71|FENR2_GRAFK Ferredoxin--NADP reductase 2 OS=Gramella forsetii (strain KT0803) GN=GFO_0330 PE=3 SV=1 16 316 4.0E-08
sp|A8YTT2|FENR_LACH4 Ferredoxin--NADP reductase OS=Lactobacillus helveticus (strain DPC 4571) GN=lhv_0465 PE=3 SV=2 22 318 4.0E-08
sp|Q4L8N5|FENR_STAHJ Ferredoxin--NADP reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0681 PE=3 SV=1 20 303 5.0E-08
sp|A9VMZ3|FENR2_BACWK Ferredoxin--NADP reductase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_4748 PE=3 SV=1 20 318 5.0E-08
sp|B1YKW2|FENR1_EXIS2 Ferredoxin--NADP reductase 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2313 PE=3 SV=1 20 329 8.0E-08
sp|Q5FH31|FENR_EHRRG Ferredoxin--NADP reductase OS=Ehrlichia ruminantium (strain Gardel) GN=ERGA_CDS_04100 PE=3 SV=1 18 335 8.0E-08
sp|Q7NBE9|FENR_MYCGA Ferredoxin--NADP reductase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=MYCGA3300 PE=3 SV=1 20 301 9.0E-08
sp|Q88UC0|FENR_LACPL Ferredoxin--NADP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2585 PE=3 SV=1 20 318 1.0E-07
sp|B3CTT3|FENR_ORITI Ferredoxin--NADP reductase OS=Orientia tsutsugamushi (strain Ikeda) GN=OTT_1322 PE=3 SV=1 13 303 1.0E-07
sp|Q8EWR4|FENR_MYCPE Ferredoxin--NADP reductase OS=Mycoplasma penetrans (strain HF-2) GN=MYPE1390 PE=3 SV=1 165 302 1.0E-07
sp|P85207|DLDH_THESS Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 20 303 2.0E-07
sp|B1HZ05|FENR1_LYSSC Ferredoxin--NADP reductase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0789 PE=3 SV=2 20 303 2.0E-07
sp|A7GUD5|FENR2_BACCN Ferredoxin--NADP reductase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_3539 PE=3 SV=1 20 318 2.0E-07
sp|A0AK73|FENR1_LISW6 Ferredoxin--NADP reductase 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe1987 PE=3 SV=1 20 316 6.0E-07
sp|Q2GCZ2|FENR_NEOSM Ferredoxin--NADP reductase OS=Neorickettsia sennetsu (strain Miyayama) GN=NSE_0779 PE=3 SV=1 16 303 7.0E-07
sp|Q0BQJ9|FENR_GRABC Ferredoxin--NADP reductase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_2006 PE=3 SV=2 6 335 1.0E-06
sp|A0LXL9|FENR1_GRAFK Ferredoxin--NADP reductase 1 OS=Gramella forsetii (strain KT0803) GN=GFO_0125 PE=3 SV=1 16 316 2.0E-06
sp|Q1WUT6|FENR_LACS1 Ferredoxin--NADP reductase OS=Lactobacillus salivarius (strain UCC118) GN=LSL_0439 PE=3 SV=1 165 318 2.0E-06
sp|B2IHR5|FENR_BEII9 Ferredoxin--NADP reductase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_2345 PE=3 SV=1 18 335 2.0E-06
sp|Q473F6|FENR1_CUPPJ Ferredoxin--NADP reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A1099 PE=3 SV=1 18 316 2.0E-06
sp|B4SFQ3|FENR_PELPB Ferredoxin--NADP reductase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=Ppha_1024 PE=3 SV=1 20 303 2.0E-06
sp|B3EKW5|FENR_CHLPB Ferredoxin--NADP reductase OS=Chlorobium phaeobacteroides (strain BS1) GN=Cphamn1_1733 PE=3 SV=1 20 303 2.0E-06
sp|A4VXW3|FENR_STRSY Ferredoxin--NADP reductase OS=Streptococcus suis (strain 05ZYH33) GN=SSU05_1986 PE=3 SV=1 20 302 2.0E-06
sp|A4W460|FENR_STRS2 Ferredoxin--NADP reductase OS=Streptococcus suis (strain 98HAH33) GN=SSU98_1991 PE=3 SV=2 20 302 2.0E-06
sp|Q5FT88|FENR_GLUOX Ferredoxin--NADP reductase OS=Gluconobacter oxydans (strain 621H) GN=GOX0631 PE=3 SV=2 14 303 2.0E-06
sp|Q04HB6|FENR_OENOB Ferredoxin--NADP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0163 PE=3 SV=1 20 302 2.0E-06
sp|A5FYH8|FENR_ACICJ Ferredoxin--NADP reductase OS=Acidiphilium cryptum (strain JF-5) GN=Acry_1452 PE=3 SV=1 13 335 3.0E-06
sp|Q49ZU9|FENR_STAS1 Ferredoxin--NADP reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0530 PE=3 SV=1 20 303 5.0E-06
sp|Q5FLU4|FENR_LACAC Ferredoxin--NADP reductase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=LBA0439 PE=3 SV=2 29 318 6.0E-06
sp|B3QXE1|FENR1_CHLT3 Ferredoxin--NADP reductase 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=Ctha_0950 PE=3 SV=1 20 303 6.0E-06
sp|Q1LPH7|FENR1_CUPMC Ferredoxin--NADP reductase 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_1063 PE=3 SV=1 17 316 7.0E-06
sp|Q219B6|FENR_RHOPB Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_1458 PE=3 SV=1 13 304 7.0E-06
sp|Q92A47|FENR1_LISIN Ferredoxin--NADP reductase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2075 PE=3 SV=1 20 316 8.0E-06
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 92 302 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099540
MPVVIPPRKNERSKKLHSKVVIIGSGPAGHTAAIYLARANLSPLMFEGFMANGFAAGGQLTTTTDVENFPGFPTG
ILGPELMEKFREQSIRFGTRIITETVSKIDLSSRPFRYWREMQEGDEPETADTIIIATGASAKRLGLKGEQTYWQ
SGISACAVCDGAVPIFRNKPLAVIGGGDSAAEEATYLTKYGSHVYVLVRRAELRASKIMANRVLKNPKITVLWNT
VAVECQGDGDLLNNLRIKNVQTGEERDLAVNGLFYAIGHEPATAIVRSQLQTDPDGYIITVPGTTETSVKGVFAA
GDVQDKRYRQAITSAGSGCMAALEVEKLIAEEEELGEIDM*
Coding >AgabiH97|099540
ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTGATCATTGGATCA
GGTCCTGCTGGACATACCGCTGCTATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATG
GCCAATGGATTCGCCGCTGGTGGCCAACTTACTACTACCACTGATGTCGAGAACTTCCCGGGCTTTCCTACTGGC
ATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGAACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACA
GTATCGAAAATAGATCTATCTTCACGTCCTTTCAGATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACT
GCTGATACTATTATCATTGCTACTGGTGCTAGTGCAAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAG
AGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGCTGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGT
GGTGGTGATTCTGCTGCGGAAGAAGCTACATATTTGACCAAGTATGGGTCACATGTGTATGTCCTAGTCCGACGT
GCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAACTGTGCTTTGGAACACC
GTAGCTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAG
CGTGACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTC
CAAACTGACCCTGATGGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCG
GGTGATGTACAAGATAAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTT
GAGAAGCTCATTGCGGAGGAAGAGGAGCTCGGTGAGATCGACATGTAA
Transcript >AgabiH97|099540
ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTGATCATTGGATCA
GGTCCTGCTGGACATACCGCTGCTATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATG
GCCAATGGATTCGCCGCTGGTGGCCAACTTACTACTACCACTGATGTCGAGAACTTCCCGGGCTTTCCTACTGGC
ATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGAACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACA
GTATCGAAAATAGATCTATCTTCACGTCCTTTCAGATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACT
GCTGATACTATTATCATTGCTACTGGTGCTAGTGCAAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAG
AGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGCTGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGT
GGTGGTGATTCTGCTGCGGAAGAAGCTACATATTTGACCAAGTATGGGTCACATGTGTATGTCCTAGTCCGACGT
GCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAACTGTGCTTTGGAACACC
GTAGCTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAG
CGTGACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTC
CAAACTGACCCTGATGGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCG
GGTGATGTACAAGATAAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTT
GAGAAGCTCATTGCGGAGGAAGAGGAGCTCGGTGAGATCGACATGTAA
Gene >AgabiH97|099540
ATGCCCGTGGTAATACCCCCGAGAAAAAATGAGCGAAGTAAGAAATTGCATTCGAAAGTGGTATGTCTTGTTTTT
TTCTTTGAACTGATGAAGCGCTTATGATTATCGTAGGTGATCATTGGATCAGGTCCTGCTGGACATACCGCTGCT
ATATACCTTGCTCGTGCAAACCTTTCTCCTTTGATGTTTGAAGGATTCATGGCCAATGGATTCGCCGCTGGTGGC
CAACTTACTACTACCACTGATGGTAAATATCCACTTCATCTTTACGAGCGACTTCCCGTCACTAATAACGATGTG
CATTTTTCTAGTCGAGAACTTCCCGGGCTTTCCTACTGGCATCCTAGGTCCAGAACTCATGGAGAAATTCCGTGA
ACAATCTATTCGTTTTGGAACACGTATCATCACAGAGACAGTATCGAAAATAGATCTATCTTCACGTCCTTTCAG
ATATTGGAGGGAAATGCAAGAAGGAGACGAACCAGAGACTGCTGATACTATTATCATTGCTACTGGTGCTAGTGC
AAAGAGGTTGGGATTGAAAGGAGAACAGACTTATTGGCAGAGTGGGATTAGTGCTTGTGCGGTATGTGATGGTGC
TGTGCCAATTTTTAGAAACAAACCATTGGCGGTGATCGGTGGTGGTGATTCTGCTGCGGAAGAAGCTACATGTAC
GTTGGGGTTTTTCGTCGTTTCCTCGAGTAATATGCTGAGGATCGATAGATTTGACCAAGTATGGGTCACATGTGT
ATGTCCTAGTCCGACGTGCAGAGCTCCGTGCCTCGAAAATTATGGCGAACAGGGTATTGAAAAATCCAAAGATAG
TGGGTTCTCAACATCGCGCCAACTCGAAAGTTCATTGATGCAAATATTAATAGACTGTGCTTTGGAACACCGTAG
CTGTCGAGTGTCAAGGTGACGGTGATTTATTAAACAACCTTCGCATAAAAAACGTTCAGACGGGTGAAGAGCGTG
ACCTTGCTGTCAACGGCCTTTTCTATGCTATTGGTACGTCTTCTAAGTGCACTTCATCTGGCCTTGGGCAGTATG
GTTGATCTCATCGACCCTTCAGGTCACGAGCCGGCCACAGCTATAGTCCGCTCGCAGCTCCAAACTGACCCTGAT
GGATACATCATCACTGTTCCCGGTACAACCGAGACGTCTGTCAAGGGAGTGTTTGCCGCGGGTGATGTACAAGAT
AAGCGATACAGGCAGGCGATTACTAGTGCTGGCAGTGGTTGTATGGCTGCGTTGGAGGTTGAGAAGCTCATTGCG
GAGGAAGAGGAGCTCGGTGAGATCGACATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail