Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099530
Gene name
Locationscaffold_7:659007..661522
Strand-
Gene length (bp)2515
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 288 310 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099530
MFPSTQHKNSFHLVSLPHAIWLAVGTTLASSLQGAHAYSWNLRSDAKQCRNATIILNGSGGKPPYKLLMIPYGAT
PLKVEARRIVEQVFATGDQTSGEIMVNYPADSQFVAVVSDASGFGTGGTSVATQVGDSDNSSCFDATKDVSPAFV
FNIEPANQFIQCQSMRIWWDPATVRGNPTFQAVIPGGQSFTIPQGDHSQVPNQGIGFNWVPNVKTGTTVLLVGGD
DRGIGTAGSGYYVVGGGTLNDASCLGSNPPSSTAGTPAGVALPTGGNHAGGGGGGGGGGSNTGAIVGGVVGGVAF
ISCLILVLFWHRRRHGHRKRAKERPVDLLHDDEDSEDDHRRNAQPQTQQQLDYYTPEPFLVPDPTLHSDGTSATD
AGGGFRTSSDGRPISGTSFTRSDTQDLLGGGSAYGLGGYGWAGGSTTTNNSRKGAMRLRPVNIVQHEDAGPPPPP
PSNGAGEEESETIELPPAYTAVQKRVVDAAEGSQPSVGGGSSTASAPIAAPATAMTATHPDTTAATTSTGNATTP
GVESGRQ*
Coding >AgabiH97|099530
ATGTTCCCTTCCACTCAACACAAAAATTCTTTCCATCTCGTTTCGCTTCCCCATGCCATCTGGCTCGCCGTAGGG
ACAACCCTGGCATCTTCGCTTCAGGGTGCTCATGCCTATTCCTGGAACTTGCGTAGTGATGCTAAACAATGCAGA
AATGCTACGATCATTCTGAATGGGAGTGGTGGAAAACCGCCGTACAAGTTACTTATGATACCCTATGGAGCCACT
CCTTTGAAGGTCGAGGCTAGGAGAATTGTTGAACAAGTCTTTGCTACGGGCGACCAGACGAGCGGAGAAATAATG
GTTAATTATCCTGCGGATTCACAGTTTGTCGCTGTGGTTAGTGATGCCTCGGGTTTTGGTACAGGGGGGACGAGT
GTGGCTACACAAGTCGGTGATTCGGATAATTCATCGTGCTTTGATGCTACGAAGGATGTTTCGCCGGCTTTCGTG
TTCAATATTGAACCTGCGAATCAGTTCATTCAATGTCAAAGTATGCGGATATGGTGGGATCCTGCAACGGTTCGA
GGAAATCCAACCTTCCAAGCAGTTATTCCAGGAGGTCAGAGTTTTACGATACCTCAAGGAGATCACTCGCAAGTC
CCGAACCAAGGTATTGGGTTCAATTGGGTACCTAATGTTAAAACCGGGACTACGGTGCTGTTGGTGGGTGGGGAT
GATAGAGGGATTGGGACTGCTGGAAGCGGTTATTATGTCGTTGGTGGTGGAACTTTGAATGATGCGTCGTGTTTG
GGTTCGAATCCACCGAGTTCCACGGCTGGTACTCCTGCTGGTGTAGCTCTTCCTACGGGCGGTAATCATGCGGGT
GGAGGTGGTGGCGGTGGTGGGGGTGGTTCGAATACGGGAGCTATCGTCGGGGGTGTTGTTGGAGGGGTGGCATTC
ATCTCTTGCCTCATACTTGTCCTTTTCTGGCACCGACGTCGTCACGGACACCGAAAACGAGCCAAAGAACGACCT
GTGGATTTGCTTCACGATGATGAAGATTCAGAGGACGATCATCGACGAAATGCGCAACCTCAAACGCAACAACAA
TTAGATTATTATACGCCTGAACCATTCCTAGTACCCGACCCAACATTACATTCAGACGGAACATCAGCAACTGAT
GCCGGTGGTGGTTTCAGAACATCGTCGGATGGTCGTCCGATAAGTGGGACTTCCTTTACTCGGAGTGATACCCAA
GATTTGCTTGGTGGAGGGAGTGCTTATGGGTTGGGTGGATATGGATGGGCTGGTGGGAGCACTACTACGAATAAT
AGTAGGAAGGGCGCTATGAGGTTGAGGCCGGTGAATATTGTTCAACATGAAGATGCAGGACCGCCTCCGCCTCCT
CCGTCGAATGGTGCAGGAGAGGAGGAATCGGAGACGATAGAGTTGCCACCTGCGTATACGGCTGTGCAGAAACGA
GTTGTTGATGCGGCTGAGGGGTCACAACCTTCGGTGGGAGGAGGATCGAGTACTGCTTCTGCACCTATTGCTGCA
CCTGCAACCGCTATGACTGCCACCCATCCTGATACCACCGCTGCTACGACTTCGACTGGAAATGCGACAACGCCT
GGAGTGGAATCTGGACGACAGTGA
Transcript >AgabiH97|099530
ATGTTCCCTTCCACTCAACACAAAAATTCTTTCCATCTCGTTTCGCTTCCCCATGCCATCTGGCTCGCCGTAGGG
ACAACCCTGGCATCTTCGCTTCAGGGTGCTCATGCCTATTCCTGGAACTTGCGTAGTGATGCTAAACAATGCAGA
AATGCTACGATCATTCTGAATGGGAGTGGTGGAAAACCGCCGTACAAGTTACTTATGATACCCTATGGAGCCACT
CCTTTGAAGGTCGAGGCTAGGAGAATTGTTGAACAAGTCTTTGCTACGGGCGACCAGACGAGCGGAGAAATAATG
GTTAATTATCCTGCGGATTCACAGTTTGTCGCTGTGGTTAGTGATGCCTCGGGTTTTGGTACAGGGGGGACGAGT
GTGGCTACACAAGTCGGTGATTCGGATAATTCATCGTGCTTTGATGCTACGAAGGATGTTTCGCCGGCTTTCGTG
TTCAATATTGAACCTGCGAATCAGTTCATTCAATGTCAAAGTATGCGGATATGGTGGGATCCTGCAACGGTTCGA
GGAAATCCAACCTTCCAAGCAGTTATTCCAGGAGGTCAGAGTTTTACGATACCTCAAGGAGATCACTCGCAAGTC
CCGAACCAAGGTATTGGGTTCAATTGGGTACCTAATGTTAAAACCGGGACTACGGTGCTGTTGGTGGGTGGGGAT
GATAGAGGGATTGGGACTGCTGGAAGCGGTTATTATGTCGTTGGTGGTGGAACTTTGAATGATGCGTCGTGTTTG
GGTTCGAATCCACCGAGTTCCACGGCTGGTACTCCTGCTGGTGTAGCTCTTCCTACGGGCGGTAATCATGCGGGT
GGAGGTGGTGGCGGTGGTGGGGGTGGTTCGAATACGGGAGCTATCGTCGGGGGTGTTGTTGGAGGGGTGGCATTC
ATCTCTTGCCTCATACTTGTCCTTTTCTGGCACCGACGTCGTCACGGACACCGAAAACGAGCCAAAGAACGACCT
GTGGATTTGCTTCACGATGATGAAGATTCAGAGGACGATCATCGACGAAATGCGCAACCTCAAACGCAACAACAA
TTAGATTATTATACGCCTGAACCATTCCTAGTACCCGACCCAACATTACATTCAGACGGAACATCAGCAACTGAT
GCCGGTGGTGGTTTCAGAACATCGTCGGATGGTCGTCCGATAAGTGGGACTTCCTTTACTCGGAGTGATACCCAA
GATTTGCTTGGTGGAGGGAGTGCTTATGGGTTGGGTGGATATGGATGGGCTGGTGGGAGCACTACTACGAATAAT
AGTAGGAAGGGCGCTATGAGGTTGAGGCCGGTGAATATTGTTCAACATGAAGATGCAGGACCGCCTCCGCCTCCT
CCGTCGAATGGTGCAGGAGAGGAGGAATCGGAGACGATAGAGTTGCCACCTGCGTATACGGCTGTGCAGAAACGA
GTTGTTGATGCGGCTGAGGGGTCACAACCTTCGGTGGGAGGAGGATCGAGTACTGCTTCTGCACCTATTGCTGCA
CCTGCAACCGCTATGACTGCCACCCATCCTGATACCACCGCTGCTACGACTTCGACTGGAAATGCGACAACGCCT
GGAGTGGAATCTGGACGACAGTGA
Gene >AgabiH97|099530
ATGTTCCCTTCCACTCAACACAAAAATTCTTTCCATCTCGTTTCGCTTCCCCATGCCATCTGGCTCGCCGTAGGG
ACAACCCTGGCATCTTCGCTTCAGGGTGCTCATGCCTATTCCTGGAACTTGCGTAGTGATGCTAAACAATGCAGA
AATGCTACGATCATTCTGAATGGGAGTGGTGGAAAACCGCCGTACAAGTTACTTATGATACCCTATGGAGCCACT
CCTTTGAAGGTCGAGGCTAGGAGAATTGTTGAACAAGTCTTTGCTACGGGCGACCAGACGAGCGGAGAAATAATG
GTTAATTATCCTGCGGATTCACAGTTTGTCGCTGTGGTGAGTCGTTTATCCCCTCTCAAAATTCCCCTCTATTGT
TCTTTTTCCTCTTCCTCCCTACACACATTTTTTTTGGTTCGTGTGTGGCGGTTAAAATGCGCGTTCTTTCTTTGA
TCGGGGAAGAATAAGAAAAGTGCCAGCCGATTAGCTATCCTGTGCTGCGGACGTGCATGCATGCTATAACCGACT
TGGCAGGCGCTTTGTGGAGTCTCTTGCTCCACTACATATCAACTGCCTTAGTTGACCTTGTCCCAGTCGGAGGGA
GTCCACCGTGCCCGATATCTTGGGATCGGCGTTCGTGTTTGTATCACGTCGATCCATACATGGCTCAGCAGCCTG
GACAAGACGGCCAACATTTACCGTCTCATGTGTTCTATTTTCCGCTTTTGATCGGATAATTGAACGAGCGAGAAG
CCTCTTTTGGCTGTCTTGGTTCATCTTGTTCTCGAAGAGGGCGATGCATATTCTCATCCTTGTGCTTTTGTTCTC
GTGGGCATGAGCATCACGAGGATTTTCCGCCTTGGGATCTCATTGCTGGTGGATTTTCCCTGGATTCCGGGAGCT
TGTCATTCGGTGCTAGTAATGAACTTCAACTAGCACCCTGCATCAAATATTTATAACACTCCTTCTGCTTCTCCA
ACTCCATTTATTCTTATGACGAATCCCTCCTCTGAGCTTAGCGCAAAAGAAAATGAAACTAATTCGGCAAAATTT
ATTCTCCTAGGTTAGTGATGCCTCGGGTTTTGGTACAGGGGGGACGAGTGTGGCTACACAAGTCGGTGATTCGGA
TAATTCATCGTGCTTTGATGCTACGAAGGATGTTTCGCCGGCTTTCGTGTTCAATATTGAACCTGCGAATCAGTT
CATTCAATGTCAAAGTATGCGGATATGGTGGGATCCTGCAACGGTTCGAGGGTACGTGGGGGTTAATTGCTTATC
CCGTACTGCGCTAAATTCATTTCACCCCTACTTTTCACTGTTCGCTGTCGATCGGACTCATTTATTCGCCAACCC
CCTATCCCGATCAATTCATTTTTATATTTATAGAAATCCAACCTTCCAAGCAGTTATTCCAGGAGGTCAGAGTTT
TACGATACCTCAAGGAGATCACTCGCAAGTCCCGAACCAAGGTATTGGGTTCAATTGGGTACCTAATGTTAAAAC
CGGGACTACGGTGCTGTTGGTGGGTGGGGATGATAGAGGGATTGGGACTGCTGGAAGCGGTTATTATGTCGTTGG
TGGTGGAACTTTGAATGATGCGTCGTGTTTGGGTTCGAATCCACCGAGTTCCACGGCTGGTACTCCTGCTGGTGT
AGCTCTTCCTACGGGCGGTAATCATGCGGGTGGAGGTGGTGGCGGTGGTGGGTAAGTGAAGATCTATACTCGATT
TTTTTACATCCTCTTACTCATTTTTTTCTTTCGTAGGGGTGGTTCGAATACGGGAGCTATCGTCGGGGGTGTTGT
TGGAGGGGTGGCATTCATCTCTTGCCTCATACTTGTCCTTTTCTGGCACCGACGTCGTCACGGACACCGAAAACG
AGCCAAAGAACGACCTGTGGATTTGCTTCACGATGATGAAGATTCAGAGGACGATCATCGACGAAATGCGCAACC
TCAAACGCAACAACAATTAGATTATTATACGCCTGAACCATTCCTAGTACCCGACCCAACATTACATTCAGACGG
AACATCAGCAACTGATGCCGGTGGTGGTTTCAGAACATCGTCGGATGGTCGTCCGATAAGTGGGACTTCCTTTAC
TCGGAGTGATACCCAAGATTTGCTTGGTGGAGGGAGTGCTTATGGGTTGGGTGGATATGGATGGGCTGGTGGGAG
CACTACTACGAATAATAGTAGGAAGGGCGCTATGAGGTTGAGGCCGGTGAATATTGTTCAACATGAAGATGCAGG
ACCGCCTCCGCCTCCTCCGTCGAATGGTGCAGGAGAGGAGGAATCGGAGACGATAGAGTTGCCACCTGCGTATAC
GGCTGTGCAGAAACGAGTTGTTGATGCGGCTGAGGGGTCACAACCTTCGGTGGGAGGAGGATCGAGTACTGCTTC
TGCACCTATTGCTGCACCTGCAACCGCTATGACTGCCACCCATCCTGATACCACCGCTGCTACGACTTCGACTGG
AAATGCGACAACGCCTGGAGTGGAATCTGGACGACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail