Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099260
Gene name
Locationscaffold_7:584479..585191
Strand+
Gene length (bp)712
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 43 139 8.0E-11
sp|Q55G31|EXPL1_DICDI Expansin-like protein 1 OS=Dictyostelium discoideum GN=expl1 PE=2 SV=1 54 137 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099260
MMFFRAACTVLATLGLILSALGAPAPTVNTIDAVHLEKRITHTGRGTWFHVGLGNCGKWNKDSDYIVAISKDLYD
NNKASNCDQYVEITNTDNGRTIHALTRDSCPSCGYYDLDLSPDAFKALAPLDQGVMSKMKWHFMNRNWHP*
Coding >AgabiH97|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCAACACCATAGACGCAGTCCACCTAGAAAAAAGGATCACGCACACCGGAAGGGGAACATGGTTCCAT
GTTGGCCTAGGAAACTGTGGCAAATGGAACAAAGACTCCGACTACATCGTTGCCATTTCTAAGGATCTTTACGAC
AACAACAAAGCTAGTAATTGCGATCAGTATGTAGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTT
ACACGGGACAGTTGTCCTAGCTGTGGATATTACGACCTCGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCC
CTTGATCAGGGTGTGATGAGCAAAATGAAATGGCATTTCATGAACAGGAATTGGCATCCTTGA
Transcript >AgabiH97|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCAACACCATAGACGCAGTCCACCTAGAAAAAAGGATCACGCACACCGGAAGGGGAACATGGTTCCAT
GTTGGCCTAGGAAACTGTGGCAAATGGAACAAAGACTCCGACTACATCGTTGCCATTTCTAAGGATCTTTACGAC
AACAACAAAGCTAGTAATTGCGATCAGTATGTAGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTT
ACACGGGACAGTTGTCCTAGCTGTGGATATTACGACCTCGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCC
CTTGATCAGGGTGTGATGAGCAAAATGAAATGGCATTTCATGAACAGGAATTGGCATCCTTGA
Gene >AgabiH97|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCAACACCATAGACGCAGTCCACCTAGAAAAAAGGATCACGCACACCGGAAGGGTAAGTTCATTCTTT
TGTCCTTCGTCACAATGATCGTTTTCTGACGTTGTCATATTTAGGGAACATGGTTCCATGTTGGTAAGTCTAATA
TCAAGATGTCATTGCCTCCAGCATTGTAATAATGTTGTTCTTCGCGAAATTAGGCCTAGGAAACTGTGGCAAATG
GAACAAAGACTCCGACTACATCGTTGCCATTTCTAAGGATCTTTACGACAACAACAAAGCTAGTAATTGCGATCA
GGTAAGAACTGCCGCTTTCGGATTTCTATATATAACCTCGGCATGCTGATAACATGTTTTCCCTTCGTATTTTTA
GTATGTAGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTTACACGGGACAGTTGTCCTAGCTGTGG
ATATTACGACCTCGGTACGCTTGTTTTTCGGCTACAGACGTGCCCATTCATTTCTCATGGTGTTAATCTGGCGTA
TTCTCATGTTACAGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCCCTTGATCAGGGTGTGATGAGCAAAAT
GAAATGGCATTTCATGAACAGGAATTGGCATCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail