Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099220
Gene name
Locationscaffold_7:575350..576602
Strand+
Gene length (bp)1252
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04857 CAF1 CAF1 family ribonuclease 8.2E-12 13 130
PF04857 CAF1 CAF1 family ribonuclease 6.7E-06 148 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZJV9|CNOT7_CHICK CCR4-NOT transcription complex subunit 7 OS=Gallus gallus GN=CNOT7 PE=2 SV=1 10 271 3.0E-115
sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subunit 7 OS=Mus musculus GN=Cnot7 PE=1 SV=1 10 271 3.0E-115
sp|Q3ZC01|CNOT7_BOVIN CCR4-NOT transcription complex subunit 7 OS=Bos taurus GN=CNOT7 PE=2 SV=1 10 271 3.0E-115
sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 OS=Homo sapiens GN=CNOT7 PE=1 SV=3 10 271 3.0E-115
sp|Q3KQ85|CNOT7_XENLA CCR4-NOT transcription complex subunit 7 OS=Xenopus laevis GN=cnot7 PE=1 SV=1 10 271 2.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZJV9|CNOT7_CHICK CCR4-NOT transcription complex subunit 7 OS=Gallus gallus GN=CNOT7 PE=2 SV=1 10 271 3.0E-115
sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subunit 7 OS=Mus musculus GN=Cnot7 PE=1 SV=1 10 271 3.0E-115
sp|Q3ZC01|CNOT7_BOVIN CCR4-NOT transcription complex subunit 7 OS=Bos taurus GN=CNOT7 PE=2 SV=1 10 271 3.0E-115
sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 OS=Homo sapiens GN=CNOT7 PE=1 SV=3 10 271 3.0E-115
sp|Q3KQ85|CNOT7_XENLA CCR4-NOT transcription complex subunit 7 OS=Xenopus laevis GN=cnot7 PE=1 SV=1 10 271 2.0E-114
sp|Q08BM8|CNOT7_DANRE CCR4-NOT transcription complex subunit 7 OS=Danio rerio GN=cnot7 PE=2 SV=1 10 271 3.0E-114
sp|A4II96|CNOT7_XENTR CCR4-NOT transcription complex subunit 7 OS=Xenopus tropicalis GN=cnot7 PE=2 SV=1 10 271 3.0E-114
sp|Q9D8X5|CNOT8_MOUSE CCR4-NOT transcription complex subunit 8 OS=Mus musculus GN=Cnot8 PE=2 SV=1 10 261 2.0E-113
sp|Q9UFF9|CNOT8_HUMAN CCR4-NOT transcription complex subunit 8 OS=Homo sapiens GN=CNOT8 PE=1 SV=1 10 261 2.0E-113
sp|O74856|CAF1_SCHPO Poly(A) ribonuclease pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf1 PE=1 SV=2 10 314 2.0E-106
sp|Q9SKZ2|CAF1G_ARATH Probable CCR4-associated factor 1 homolog 7 OS=Arabidopsis thaliana GN=CAF1-7 PE=2 SV=2 4 261 6.0E-98
sp|Q9SAI2|CAF1F_ARATH Probable CCR4-associated factor 1 homolog 6 OS=Arabidopsis thaliana GN=CAF1-6 PE=2 SV=1 4 261 6.0E-97
sp|Q9LEU4|CAF1J_ARATH Probable CCR4-associated factor 1 homolog 10 OS=Arabidopsis thaliana GN=CAF1-10 PE=2 SV=1 4 261 3.0E-90
sp|Q9S9P2|CAF1B_ARATH Probable CCR4-associated factor 1 homolog 2 OS=Arabidopsis thaliana GN=CAF1-2 PE=1 SV=1 4 260 8.0E-83
sp|Q17345|CNOT7_CAEEL CCR4-NOT transcription complex subunit 7 OS=Caenorhabditis elegans GN=ccf-1 PE=2 SV=1 9 277 3.0E-81
sp|Q9FMS6|CAF1K_ARATH Probable CCR4-associated factor 1 homolog 11 OS=Arabidopsis thaliana GN=CAF1-11 PE=2 SV=1 10 260 2.0E-68
sp|Q9LXM2|CAF1I_ARATH Probable CCR4-associated factor 1 homolog 9 OS=Arabidopsis thaliana GN=CAF1-9 PE=2 SV=1 11 260 1.0E-62
sp|P39008|POP2_YEAST Poly(A) ribonuclease POP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP2 PE=1 SV=2 10 260 4.0E-57
sp|Q9SHJ0|CAF1A_ARATH Probable CCR4-associated factor 1 homolog 1 OS=Arabidopsis thaliana GN=CAF1-1 PE=2 SV=1 8 263 8.0E-37
sp|Q9LXM4|CAF1H_ARATH Putative CCR4-associated factor 1 homolog 8 OS=Arabidopsis thaliana GN=CAF1-8 PE=3 SV=1 22 239 4.0E-28
sp|O64773|CAF1E_ARATH Probable CCR4-associated factor 1 homolog 5 OS=Arabidopsis thaliana GN=CAF1-5 PE=2 SV=1 12 239 2.0E-27
sp|Q9SFX6|CAF1C_ARATH Putative CCR4-associated factor 1 homolog 3 OS=Arabidopsis thaliana GN=CAF1-3 PE=3 SV=1 12 239 2.0E-27
sp|Q9C6M9|CAF1D_ARATH Putative CCR4-associated factor 1 homolog 4 OS=Arabidopsis thaliana GN=CAF1-4 PE=3 SV=1 12 239 2.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099220
MAGRNDGPEIQDVWATNLEMEMEKIRALIDQFPYVAMDTEFPGVVARPIGTFKTSSDYHYQTMRCNVDLLRIIQV
GITLANEDGEHPIECGTWQFNFKFNIDDDIYAPESIDLLQKSGIDFQQHAEYGISPNDFAELMITSGLVLLPDTK
WISFHSGYDFGYFIKLLTAESLPTTEDDFFSLLRTWFPIVYDIKFLMRSCKQLKGGLQDVADDLGVMRHGASHQA
GSDSLLTSQTFFKLREVYFNGEIDDAEYSGKLYGLGQTFSMINGLTDPSRGGATIAERDDRNSSIRDLHNQTPGP
VGGPQGQGVSMNMTLQALSSMSPGAYTNQMGVNGPYMRTSLVGGR*
Coding >AgabiH97|099220
ATGGCCGGTCGCAATGATGGGCCGGAAATACAGGATGTTTGGGCGACAAACCTAGAGATGGAAATGGAGAAAATA
AGAGCTTTAATCGACCAGTTTCCCTATGTCGCCATGGATACCGAATTCCCTGGTGTCGTTGCGCGGCCTATAGGA
ACGTTCAAGACGTCTTCAGATTACCATTACCAGACGATGCGGTGTAACGTGGACCTGCTAAGGATCATTCAAGTA
GGAATCACTTTGGCAAATGAGGATGGGGAACACCCGATTGAATGTGGAACGTGGCAATTCAACTTCAAGTTCAAC
ATTGACGATGATATCTACGCACCAGAGTCAATTGATCTGCTTCAGAAATCAGGCATAGACTTTCAGCAGCATGCG
GAATATGGGATATCGCCCAACGATTTTGCAGAGCTTATGATTACTTCGGGCCTGGTGTTGCTTCCTGACACGAAG
TGGATATCATTCCATAGTGGCTATGACTTTGGCTACTTTATCAAGCTTCTAACCGCTGAATCCCTTCCAACCACA
GAAGACGATTTCTTCTCCCTCCTTCGTACATGGTTCCCAATCGTCTATGACATCAAGTTTCTGATGCGCTCGTGT
AAACAATTAAAAGGCGGTCTTCAAGACGTTGCGGATGATCTCGGGGTGATGCGCCACGGTGCATCACATCAAGCT
GGCTCGGATTCACTCTTAACGTCACAGACATTCTTCAAACTCAGAGAAGTATACTTTAACGGTGAAATCGACGAT
GCAGAGTATTCGGGCAAGTTATACGGCCTAGGTCAAACCTTCTCCATGATCAATGGCCTCACGGATCCTTCGCGA
GGTGGAGCGACGATAGCTGAGCGTGATGATCGAAATTCTTCTATACGAGACCTCCACAATCAAACACCAGGACCT
GTTGGAGGGCCGCAGGGGCAAGGTGTGAGCATGAACATGACTCTGCAAGCGCTTTCATCCATGTCACCAGGAGCT
TATACCAATCAAATGGGTGTAAATGGACCATACATGCGTACCTCCTTAGTTGGTGGTAGATAA
Transcript >AgabiH97|099220
ATGGCCGGTCGCAATGATGGGCCGGAAATACAGGATGTTTGGGCGACAAACCTAGAGATGGAAATGGAGAAAATA
AGAGCTTTAATCGACCAGTTTCCCTATGTCGCCATGGATACCGAATTCCCTGGTGTCGTTGCGCGGCCTATAGGA
ACGTTCAAGACGTCTTCAGATTACCATTACCAGACGATGCGGTGTAACGTGGACCTGCTAAGGATCATTCAAGTA
GGAATCACTTTGGCAAATGAGGATGGGGAACACCCGATTGAATGTGGAACGTGGCAATTCAACTTCAAGTTCAAC
ATTGACGATGATATCTACGCACCAGAGTCAATTGATCTGCTTCAGAAATCAGGCATAGACTTTCAGCAGCATGCG
GAATATGGGATATCGCCCAACGATTTTGCAGAGCTTATGATTACTTCGGGCCTGGTGTTGCTTCCTGACACGAAG
TGGATATCATTCCATAGTGGCTATGACTTTGGCTACTTTATCAAGCTTCTAACCGCTGAATCCCTTCCAACCACA
GAAGACGATTTCTTCTCCCTCCTTCGTACATGGTTCCCAATCGTCTATGACATCAAGTTTCTGATGCGCTCGTGT
AAACAATTAAAAGGCGGTCTTCAAGACGTTGCGGATGATCTCGGGGTGATGCGCCACGGTGCATCACATCAAGCT
GGCTCGGATTCACTCTTAACGTCACAGACATTCTTCAAACTCAGAGAAGTATACTTTAACGGTGAAATCGACGAT
GCAGAGTATTCGGGCAAGTTATACGGCCTAGGTCAAACCTTCTCCATGATCAATGGCCTCACGGATCCTTCGCGA
GGTGGAGCGACGATAGCTGAGCGTGATGATCGAAATTCTTCTATACGAGACCTCCACAATCAAACACCAGGACCT
GTTGGAGGGCCGCAGGGGCAAGGTGTGAGCATGAACATGACTCTGCAAGCGCTTTCATCCATGTCACCAGGAGCT
TATACCAATCAAATGGGTGTAAATGGACCATACATGCGTACCTCCTTAGTTGGTGGTAGATAA
Gene >AgabiH97|099220
ATGGCCGGTCGCAATGATGGGCCGGAAATACAGGATGTTTGGGCGACAAACCTAGAGATGGAAATGGAGAAAATA
AGAGCTTTAATCGACCAGTTTCCCTATGTCGCCATGGTACGTGCAAGCGTCCTCCTTCGCTGACCTACATAACGG
TGTGAACACAGGATACCGAATTCCCTGGTGTCGTTGCGCGGCCTATAGGAACGTTCAAGACGTCTTCAGATTACC
ATTACCAGACGATGCGGTGTAACGTGGACCTGCTAAGGATCATTCAAGTAGGAATCACTTTGGCAAATGAGGATG
GGGAACACCCGATTGAATGTGGAACGTGGCAATTCAACTTCAAGTTCAACATTGAGTCAGTCGTTGTAGAATTGC
GTTAAATGGTCAGCTGACGTATATTCTTTGCGACCAATAGCGATGATATCTACGCACCAGAGTCAATTGATCTGC
TTCAGAAATCAGGCATAGACTTTCAGCAGCATGCGGAATATGGGATATCGCCCAACGATTTTGCAGAGCTTATGA
TTACTTCGGGCCTGGTGTTGCTTCCTGACACGAAGTGGATATCATTCCATAGGTACGTCCCTACTCGTGTGCCCC
CGCCTGTTCTTGCCTTATTCCTCGGTCACAGTGGCTATGACTTTGGCTACTTTATCAAGCTTCTAACCGCTGAAT
CCCTTCCAACCACAGAAGACGATTTCTTCTCCCTCCTTCGTACATGGTTCCCAATCGTCTATGACATCAAGTTTC
TGATGCGCTCGTGTAAACAATTAAAAGGCGGTCTTCAAGACGTTGCGGATGATCTCGGGGTACGTATCTGTCTGT
TCGGCCATTTCAATGCTTTATTTGGAATTTACAGGTGATGCGCCACGGTGCATCACATCAAGCTGGCTCGGATTC
ACTCTTAACGTCACAGACATTCTTCAAACTCAGAGAAGTATACTTTAACGGTGAAATCGACGATGCAGAGTATTC
GGGCAAGTTATACGGCCTAGGTCAAACCTTCTCCATGATCAATGGCCTCACGGATCCTTCGCGAGGTGGAGCGAC
GATAGCTGAGCGTGATGATCGAAATTCTTCTATACGAGACCTCCACAATCAAACACCAGGACCTGTTGGAGGGCC
GCAGGGGCAAGGTGTGAGCATGAACATGACTCTGCAAGCGCTTTCATCCATGTCACCAGGAGCTTATACCAATCA
AATGGGTGTAAATGGACCATACATGCGTACCTCCTTAGTTGGTGGTAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail