Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099180
Gene name
Locationscaffold_7:560025..560996
Strand+
Gene length (bp)971
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099180
MLAFAALLFSLLLSAVLGFPLAQRDVVNPTITEPHDGTVWVVGEKEMVTWKTDNFPPDSQITNPEGRVILGHLEN
DSLNLQLDHPLAANFSIRDGQVQITVPDVPPREDYIIVLMGDSGNASPAFAITAIKGSGSSSVYDPTSTNQPSTT
IGSTSAIITGPSPPTATTPTVSEPEATTVPDPMSMIVSESMPTVSSSLPDSVPAPSSSASDSTTTAPAAESPQPV
STGGAWSAHNAKLWSVMAAPVAFLFLL*
Coding >AgabiH97|099180
ATGCTCGCTTTTGCTGCCCTTTTGTTTTCGCTGCTCCTTTCTGCGGTCCTGGGCTTCCCCCTCGCTCAGCGAGAC
GTCGTCAACCCCACCATCACTGAGCCACATGATGGCACGGTCTGGGTCGTCGGCGAGAAGGAGATGGTGACATGG
AAGACGGACAATTTCCCCCCAGACTCCCAAATCACCAATCCAGAAGGGCGTGTCATTCTCGGACACCTGGAAAAT
GATAGTCTGAATCTTCAACTTGACCACCCTCTTGCCGCAAACTTCAGCATTCGAGATGGCCAAGTTCAAATCACA
GTACCCGATGTTCCCCCTCGTGAAGACTACATCATCGTTCTGATGGGTGATTCTGGCAATGCCAGCCCAGCCTTC
GCTATTACGGCTATCAAAGGCTCGGGATCTTCTTCTGTCTATGACCCGACATCAACCAACCAGCCGTCTACGACG
ATTGGTTCTACCTCTGCTATCATCACAGGTCCATCCCCTCCTACTGCTACCACCCCCACCGTCAGCGAACCAGAG
GCGACAACTGTTCCAGATCCTATGTCCATGATCGTTTCAGAGTCGATGCCAACTGTATCGAGTTCTTTACCTGAC
TCCGTCCCTGCACCCTCCTCGTCTGCAAGCGACAGTACGACAACTGCTCCCGCAGCTGAGTCTCCTCAGCCCGTT
TCGACTGGCGGTGCATGGTCTGCGCATAATGCCAAACTGTGGTCTGTTATGGCTGCGCCTGTGGCTTTCTTGTTC
TTGCTCTGA
Transcript >AgabiH97|099180
ATGCTCGCTTTTGCTGCCCTTTTGTTTTCGCTGCTCCTTTCTGCGGTCCTGGGCTTCCCCCTCGCTCAGCGAGAC
GTCGTCAACCCCACCATCACTGAGCCACATGATGGCACGGTCTGGGTCGTCGGCGAGAAGGAGATGGTGACATGG
AAGACGGACAATTTCCCCCCAGACTCCCAAATCACCAATCCAGAAGGGCGTGTCATTCTCGGACACCTGGAAAAT
GATAGTCTGAATCTTCAACTTGACCACCCTCTTGCCGCAAACTTCAGCATTCGAGATGGCCAAGTTCAAATCACA
GTACCCGATGTTCCCCCTCGTGAAGACTACATCATCGTTCTGATGGGTGATTCTGGCAATGCCAGCCCAGCCTTC
GCTATTACGGCTATCAAAGGCTCGGGATCTTCTTCTGTCTATGACCCGACATCAACCAACCAGCCGTCTACGACG
ATTGGTTCTACCTCTGCTATCATCACAGGTCCATCCCCTCCTACTGCTACCACCCCCACCGTCAGCGAACCAGAG
GCGACAACTGTTCCAGATCCTATGTCCATGATCGTTTCAGAGTCGATGCCAACTGTATCGAGTTCTTTACCTGAC
TCCGTCCCTGCACCCTCCTCGTCTGCAAGCGACAGTACGACAACTGCTCCCGCAGCTGAGTCTCCTCAGCCCGTT
TCGACTGGCGGTGCATGGTCTGCGCATAATGCCAAACTGTGGTCTGTTATGGCTGCGCCTGTGGCTTTCTTGTTC
TTGCTCTGA
Gene >AgabiH97|099180
ATGCTCGCTTTTGCTGCCCTTTTGTTTTCGCTGCTCCTTTCTGCGGTCCTGGGCTTCCCCCTCGCTCAGCGAGAC
GTCGTCAACCCCACCATCACTGAGCCACATGATGGCACGGTCTGGGTCGTCGGCGAGAAGGAGATGGTGACATGG
TATGCTAGCTTTCCACGCCAACGTTGTTTCATGGTTGACTGACAATACCTCTAGGAAGACGGACAATTTCCCCCC
AGACTCCCAAATCACCAATCCAGAAGGGCGTGTCATTCTCGGACACCTGGAAAATGATAGTCTGAATCTTCAACT
TGGTAGGTTATCATTCTTAATAATGGCCGTGCCACATGATCTGGCATCTATCTATCATTCATTGCTATATCTGCT
TGACGTTGACGCTAACTCAATTCGGCTTTCCCAGACCACCCTCTTGCCGCAAACTTCAGCATTCGAGATGGCCAA
GTTCAAATCACAGTACCCGATGTTCCCCCTCGTGAAGACTACATCATCGTTCGTAAGTAGCATGCGCCACTTTGC
TGGTAGCGGACTAAAGTTTTTGTGTAGTGATGGGTGATTCTGGCAATGCCAGCCCAGCCTTCGCTATTACGGCTA
TCAAAGGCTCGGGATCTTCTTCTGTCTATGACCCGACATCAACCAACCAGCCGTCTACGACGATTGGTTCTACCT
CTGCTATCATCACAGGTCCATCCCCTCCTACTGCTACCACCCCCACCGTCAGCGAACCAGAGGCGACAACTGTTC
CAGATCCTATGTCCATGATCGTTTCAGAGTCGATGCCAACTGTATCGAGTTCTTTACCTGACTCCGTCCCTGCAC
CCTCCTCGTCTGCAAGCGACAGTACGACAACTGCTCCCGCAGCTGAGTCTCCTCAGCCCGTTTCGACTGGCGGTG
CATGGTCTGCGCATAATGCCAAACTGTGGTCTGTTATGGCTGCGCCTGTGGCTTTCTTGTTCTTGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail