Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|099090
Gene name
Locationscaffold_7:545143..547339
Strand-
Gene length (bp)2196
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 4.8E-10 167 209
PF02353 CMAS Mycolic acid cyclopropane synthetase 5.4E-37 285 508
PF13649 Methyltransf_25 Methyltransferase domain 1.8E-06 312 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 288 566 7.0E-33
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 287 564 3.0E-19
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 287 564 3.0E-19
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 286 504 1.0E-17
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 96 200 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 288 566 7.0E-33
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 287 564 3.0E-19
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 287 564 3.0E-19
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 286 504 1.0E-17
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 96 200 7.0E-12
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 285 525 1.0E-11
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 285 525 1.0E-11
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 285 525 1.0E-11
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 89 201 3.0E-10
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 89 201 3.0E-10
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 285 508 7.0E-10
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 289 509 8.0E-10
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 285 530 3.0E-08
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 285 530 3.0E-08
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 285 530 3.0E-08
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 285 530 3.0E-08
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 289 417 5.0E-07
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 289 417 8.0E-07
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 289 417 8.0E-07
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 285 525 1.0E-06
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 285 525 1.0E-06
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 285 525 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|099090
MSSQILDIPSKHRFSISGFLDQTWNSVAESVMQAGWAPLTSLAEKAVVSSMQRITLGQLKVVTLERIYTFPEPSP
SGEDEFDARPEVKAEIRVLKDTFWVRLCAMGGLGFAESYMYGEVECDDLISLFQIFIDNKDNLDNMESRVPFLFS
LPQKLRSYRFLNTIGNSRSNISAHYDISNDMFAGFLSSDMTYSCAIFKDLDGDLKQDKRDDLHCLELLRDANAEV
FNNYNVQSDGRVHRNGDMNGLTNGTPINISINGHGNNLANGYPQANNQTFADQNHPGSLEDDELYEAQMRKLDHI
INKAKIQPGQRVLEIGSGWGSMAIRITQRIPGTTVDTITLSVQQQILAEKRISAVGLSDRITVHLMDYRNMPPEW
NGAFDRVVSIEMVEAVGEEFLETYWRTVEWALNPLTGAGVVQVITIPETRWDRYRTEIDFIQKWASPFVFVHSIH
LANRNSHKLPICRCVEFKRFFQEASFQRLRFLSNIGPHYARTLREWRRRFLDQFEDIIVPALQEDYPSVMGPLSG
ERGRQEIEVFKRKWIYYYCYCEIGFTTRTIGDHIITFAREGYQDFGCDVFV*
Coding >AgabiH97|099090
ATGTCCAGCCAAATTCTCGACATACCGTCTAAGCACCGTTTCTCCATATCAGGTTTCTTGGACCAAACATGGAAC
TCGGTCGCTGAGTCTGTCATGCAGGCAGGCTGGGCACCTCTCACAAGTTTGGCTGAGAAGGCCGTAGTATCGTCA
ATGCAAAGGATAACTTTGGGTCAGCTCAAAGTTGTGACGCTGGAACGTATCTATACCTTCCCAGAACCGAGTCCT
TCCGGCGAGGATGAGTTTGATGCAAGACCCGAAGTTAAAGCGGAAATACGCGTCCTTAAGGACACGTTCTGGGTT
CGACTCTGCGCTATGGGTGGTCTTGGCTTCGCGGAATCATACATGTACGGCGAAGTCGAGTGTGATGATCTTATC
TCGCTATTCCAGATTTTTATAGACAACAAAGACAATCTTGACAATATGGAGTCCCGAGTGCCTTTTTTGTTTTCT
CTCCCACAGAAGTTGAGATCTTATCGCTTTTTGAACACAATCGGCAATTCGCGATCAAATATCTCGGCTCATTAT
GATATCTCGAATGATATGTTTGCAGGGTTCCTATCCTCAGATATGACTTATTCTTGCGCGATTTTCAAAGACCTC
GATGGCGATCTCAAGCAGGACAAACGCGATGATCTACATTGTTTGGAGCTTCTTCGGGATGCAAATGCCGAAGTA
TTCAATAACTATAACGTACAATCTGATGGACGCGTTCACCGAAATGGAGATATGAATGGTCTCACTAATGGGACG
CCGATCAACATCAGCATCAACGGTCATGGAAACAATCTTGCAAATGGATATCCACAAGCTAACAATCAAACCTTT
GCTGACCAAAATCATCCAGGGTCTTTAGAGGATGATGAACTCTACGAGGCGCAAATGCGGAAATTGGATCATATC
ATCAACAAGGCTAAAATACAACCAGGGCAGCGTGTTCTAGAGATTGGCTCTGGATGGGGATCAATGGCTATTCGT
ATCACGCAGAGGATACCGGGCACGACCGTCGATACGATAACTTTATCTGTGCAACAACAAATCCTTGCCGAGAAG
CGTATCTCTGCCGTTGGTCTGTCCGATAGAATCACAGTGCACCTCATGGACTATCGGAACATGCCTCCCGAATGG
AACGGTGCGTTCGACAGAGTTGTCAGCATCGAAATGGTGGAGGCCGTAGGAGAGGAGTTCTTGGAGACCTACTGG
AGAACCGTTGAGTGGGCTCTAAACCCACTAACTGGAGCCGGCGTGGTACAAGTTATTACCATACCGGAAACAAGA
TGGGACCGCTATAGGACTGAAATTGACTTTATTCAAAAATGGGCAAGTCCATTCGTCTTCGTTCATTCCATACAT
CTCGCTAATCGCAATTCTCACAAATTACCCATCTGTCGTTGTGTTGAATTCAAAAGATTTTTCCAGGAGGCATCC
TTCCAACGCTTACGCTTCTTGTCAAATATTGGCCCACACTATGCACGAACTCTACGCGAATGGCGTAGGCGTTTC
CTCGACCAATTTGAAGACATAATCGTGCCTGCATTGCAGGAAGACTATCCATCAGTTATGGGACCTTTGAGCGGC
GAGCGTGGAAGGCAAGAAATCGAAGTATTCAAGAGGAAGTGGATATATTATTATTGTTACTGTGAAATCGGATTC
ACGACGAGAACAATTGGAGATCATATCATCACGTTTGCGCGTGAGGGATATCAGGATTTTGGATGCGACGTTTTC
GTATAA
Transcript >AgabiH97|099090
ATGTCCAGCCAAATTCTCGACATACCGTCTAAGCACCGTTTCTCCATATCAGGTTTCTTGGACCAAACATGGAAC
TCGGTCGCTGAGTCTGTCATGCAGGCAGGCTGGGCACCTCTCACAAGTTTGGCTGAGAAGGCCGTAGTATCGTCA
ATGCAAAGGATAACTTTGGGTCAGCTCAAAGTTGTGACGCTGGAACGTATCTATACCTTCCCAGAACCGAGTCCT
TCCGGCGAGGATGAGTTTGATGCAAGACCCGAAGTTAAAGCGGAAATACGCGTCCTTAAGGACACGTTCTGGGTT
CGACTCTGCGCTATGGGTGGTCTTGGCTTCGCGGAATCATACATGTACGGCGAAGTCGAGTGTGATGATCTTATC
TCGCTATTCCAGATTTTTATAGACAACAAAGACAATCTTGACAATATGGAGTCCCGAGTGCCTTTTTTGTTTTCT
CTCCCACAGAAGTTGAGATCTTATCGCTTTTTGAACACAATCGGCAATTCGCGATCAAATATCTCGGCTCATTAT
GATATCTCGAATGATATGTTTGCAGGGTTCCTATCCTCAGATATGACTTATTCTTGCGCGATTTTCAAAGACCTC
GATGGCGATCTCAAGCAGGACAAACGCGATGATCTACATTGTTTGGAGCTTCTTCGGGATGCAAATGCCGAAGTA
TTCAATAACTATAACGTACAATCTGATGGACGCGTTCACCGAAATGGAGATATGAATGGTCTCACTAATGGGACG
CCGATCAACATCAGCATCAACGGTCATGGAAACAATCTTGCAAATGGATATCCACAAGCTAACAATCAAACCTTT
GCTGACCAAAATCATCCAGGGTCTTTAGAGGATGATGAACTCTACGAGGCGCAAATGCGGAAATTGGATCATATC
ATCAACAAGGCTAAAATACAACCAGGGCAGCGTGTTCTAGAGATTGGCTCTGGATGGGGATCAATGGCTATTCGT
ATCACGCAGAGGATACCGGGCACGACCGTCGATACGATAACTTTATCTGTGCAACAACAAATCCTTGCCGAGAAG
CGTATCTCTGCCGTTGGTCTGTCCGATAGAATCACAGTGCACCTCATGGACTATCGGAACATGCCTCCCGAATGG
AACGGTGCGTTCGACAGAGTTGTCAGCATCGAAATGGTGGAGGCCGTAGGAGAGGAGTTCTTGGAGACCTACTGG
AGAACCGTTGAGTGGGCTCTAAACCCACTAACTGGAGCCGGCGTGGTACAAGTTATTACCATACCGGAAACAAGA
TGGGACCGCTATAGGACTGAAATTGACTTTATTCAAAAATGGGCAAGTCCATTCGTCTTCGTTCATTCCATACAT
CTCGCTAATCGCAATTCTCACAAATTACCCATCTGTCGTTGTGTTGAATTCAAAAGATTTTTCCAGGAGGCATCC
TTCCAACGCTTACGCTTCTTGTCAAATATTGGCCCACACTATGCACGAACTCTACGCGAATGGCGTAGGCGTTTC
CTCGACCAATTTGAAGACATAATCGTGCCTGCATTGCAGGAAGACTATCCATCAGTTATGGGACCTTTGAGCGGC
GAGCGTGGAAGGCAAGAAATCGAAGTATTCAAGAGGAAGTGGATATATTATTATTGTTACTGTGAAATCGGATTC
ACGACGAGAACAATTGGAGATCATATCATCACGTTTGCGCGTGAGGGATATCAGGATTTTGGATGCGACGTTTTC
GTATAA
Gene >AgabiH97|099090
ATGTCCAGCCAAATTCTCGACATACCGTCTAAGCACCGTTTCTCCATATCAGGTTTCTTGGACCAAACATGGAAC
TCGGTCGCTGAGTCTGTCATGCAGGCAGGCTGGGCACCTCTCACAAGTTTGGCTGAGAAGGCCGTAGTATCGTAC
GTTGTCATCACCGTTTATTCCTTTCGTTGGACTGACTGACTGGCTTTCGTCGTAGGTCAATGCAAAGGATAACTT
TGGGTCAGCTCAAAGTTGTGACGCTGGAACGTATCTATACCTTCCCAGAACCGAGTCCTTCCGGCGAGGATGAGT
TTGATGCAAGACCCGAAGTTAAAGCGGAAATACGCGTCCTTAAGGACACGTTCTGGGTTCGACTCTGCGCTATGG
GTGGTCTTGGCTTCGCGGAATCATACATGTACGGCGAAGTCGAGTGTGATGATCTTATCTCGCTATTCCAGGTAT
ACTTCCTTTACATGCAAAGCAACAGTTACAGTGCTAACGAATATACCTGGTTTAATGCTTGTTCAGATTTTTATA
GACAACAAAGACAATCTTGACAATATGGAGTCCCGAGTGCCTTTTTTGTTTTCTCTCCCACAGAAGTTGAGATCT
TATCGCTTTTTGAACACAATCGGCAATTCGCGATCAAATATCTCGGCTCATTATGATATCTCGAATGATATGTTT
GCAGGTACGTTTATCAAACAAATACCGAAGACATGGAAGTTTCGAATTATTTCCCCCAGGGTTCCTATCCTCAGA
TATGACTTATTCTTGCGCGATTTTCAAAGACCTCGATGGCGATCTCAAGCAGGACAAACGCGATGATCTACATTG
TTTGGAGCTTCTTCGGGATGCAAATGCCGAAGTATTCAATAACTATAACGTACAATCTGATGGACGCGTTCACCG
AAATGGAGATATGAATGGTCTCACTAATGGGACGCCGATCAACATCAGCATCAACGGTCATGGAAACAATCTTGC
AAATGGATATCCACAAGCTAACAATCAAACCTTTGCTGACCAAAATCATCCAGGGTCTTTAGAGGATGATGAACT
CTACGAGGCGCAAATGCGGAAATTGGATCATATCATCAACAAGGCTAAAATACAACCAGGGCAGCGTGTTCTAGA
GATTGGCTCTGGATGGGGATCAATGGCTATTCGTATCACGCAGAGGATACCGGGCACGACCGTCGATACGATAAC
TTTATCTGTGCAACAACAAATCCTTGCCGAGAAGCGTATCTCTGCCGTTGGTCTGTCCGATAGAATCACAGTGCA
CCTCATGGACTATCGGAACATGCCTCCCGAATGGAACGGTGCGTTCGACAGAGTTGTCAGCATCGAAATGGTGGA
GGCCGTAGGAGAGGAGTTCTTGGAGACCTACTGGAGAACCGTTGAGTGGGCTCTAAACCCACTAACTGGAGCCGG
CGTGGTACAAGTTATTACCATACCGGAAACAAGTATGTTCTCCCCCGGACGTTTTCCTTCCGCGTCTAACCCCAA
CAAATCAGGATGGGACCGCTATAGGACTGAAATTGACTTTATTCAAAAATGGGCAAGTCCATTCGTCTTCGTTCA
TTCCATACATCTCGCTAATCGCAATTCTCACAAATTACCCATCTGTCGTTGTGTTGAATTCAAAAGAGTACGTGT
TCTCAAAGCCTTTGATTTTGAGCTCCATTCATCAAAAAATCATGATTTCAGTTTTTCCAGGAGGCATCCTTCCAA
CGCTTACGCTTCTGTTGGATACTCTTCGTTCAGGGTCAAAAAATCGCTTGATCGTCGACTCAGTGTCAAATATTG
GCCCACACTATGCACGAACTCTACGCGAATGGCGTAGGCGTTTCCTCGACCAATTTGAAGACATAATCGTGCCTG
CATTGCAGGAAGACTATCCATCAGTTATGGGACCTTTGAGCGGCGAGCGTGGAAGGCAAGAAATCGAAGTATTCA
AGAGGAAGTGGATATGTAAGACCTGGTAACTATTTCACTGATATCTTTTGCTCAAACTTTTTCTTTCGCGATGTA
GATTATTATTGTTACTGTGAAATCGGATTCACGACGAGAACAATTGGAGGTGAGCATCTTGAGACGCGGTTGACC
CGTTGTTGTTTGGCTGAAGGTATGAACGTTGTAGATCATATCATCACGTTTGCGCGTGAGGGATATCAGGATTTT
GGATGCGACGTTTTCGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail