Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098910
Gene name
Locationscaffold_7:492347..494699
Strand-
Gene length (bp)2352
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-33 61 240
PF07690 MFS_1 Major Facilitator Superfamily 4.2E-09 329 528

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 23 525 5.0E-40
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 7 514 3.0E-37
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 38 284 4.0E-34
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 22 522 4.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 22 522 9.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 23 525 5.0E-40
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 7 514 3.0E-37
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 38 284 4.0E-34
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 22 522 4.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 22 522 9.0E-29
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 48 529 2.0E-28
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 38 238 1.0E-27
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 16 503 2.0E-27
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 6 503 5.0E-27
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 72 531 5.0E-27
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 2 538 3.0E-26
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 7 530 4.0E-26
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 2 503 1.0E-24
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 3 461 3.0E-24
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 15 503 4.0E-24
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 28 428 4.0E-24
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 42 503 2.0E-23
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 42 528 5.0E-23
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 42 529 8.0E-23
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 16 492 1.0E-22
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 2 533 4.0E-22
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 9 503 5.0E-21
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 10 533 6.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 2 532 1.0E-19
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 56 236 1.0E-19
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 325 522 3.0E-19
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 22 530 2.0E-18
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 41 531 5.0E-18
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 6 472 1.0E-17
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 6 259 6.0E-17
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 42 501 8.0E-17
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 42 501 9.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 42 259 1.0E-16
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 249 2.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 311 498 4.0E-16
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 72 426 4.0E-15
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 93 495 6.0E-14
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 74 208 1.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 42 470 7.0E-09
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 62 212 9.0E-09
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 55 214 1.0E-08
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 71 224 9.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 98 237 5.0E-07
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 117 245 5.0E-07
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 117 245 6.0E-07
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 69 221 6.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 71 212 8.0E-07
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 96 237 8.0E-07
sp|D5B5U5|MDFA_YERPZ Multidrug transporter MdfA OS=Yersinia pestis (strain Z176003) GN=mdfA PE=3 SV=2 68 221 2.0E-06
sp|A9R4E0|MDFA_YERPG Multidrug transporter MdfA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdfA PE=3 SV=2 68 221 2.0E-06
sp|D0JKF6|MDFA_YERPD Multidrug transporter MdfA OS=Yersinia pestis (strain D106004) GN=mdfA PE=3 SV=2 68 221 2.0E-06
sp|D0JUX5|MDFA_YERP1 Multidrug transporter MdfA OS=Yersinia pestis (strain D182038) GN=mdfA PE=3 SV=2 68 221 2.0E-06
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 107 235 2.0E-06
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 107 247 3.0E-06
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 44 227 3.0E-06
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 52 211 4.0E-06
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 20 211 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 91 113 22
3 120 142 22
4 146 168 22
5 180 202 22
6 207 229 22
7 321 343 22
8 358 380 22
9 400 422 22
10 427 449 22
11 462 484 22
12 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098910
MNMTLSDAEKTTEIPQNSPSDRRDSIDTAETAVDIEHVPVQDDPRSWSWLRKHFSLFLISGAAMIAGFAGTIQNP
AVADMEEQLPATSEQFSLSISLYILVQGLMPLVWCAISEIKGRKMIYLVSLAGSLVSSIAVAVSRRIELVIAFRS
IQAAGLSAVISIGAATLADMFEPAERGTKMGVYYMAPLLGPALGPIIGGALTSGLGWRSIFWFLTIVAGAIWMAF
LLFFRDTFRKERSLTYQTVLKQHAIARAKNDIGHEAALPRTPAPASTHNVHGDVEKGKEAMGKEDADALAVPAAQ
IELTLRDVNPISPLLAVVRRINNLLILTASGLMYALTYMINYTGARTLSNDYHYDALMIGVITIAYGLGCVAGSI
LGGRWSDYKLSQLKKANGGIGYPEMRLKSTTIGLIIFPPSVVGFGWACREHTHVAVLCVLLFVAGFFTIWVYSST
LAYVVDANKGRSATAVATNSAFRGTLAFIATEIAVPMQDGIGDGWLYTFWGFLMALSGLLILLVSWKGRDWRIRA
EEREAKATGMESH*
Coding >AgabiH97|098910
ATGAATATGACCTTAAGTGACGCAGAGAAAACCACCGAAATACCTCAAAATAGCCCCTCAGATCGGCGAGACTCT
ATCGACACCGCAGAAACTGCAGTGGACATAGAACATGTTCCAGTTCAAGACGATCCCCGTAGTTGGTCGTGGTTA
CGAAAGCATTTCAGTTTATTTCTGATATCGGGGGCCGCAATGATTGCTGGTTTCGCCGGTACGATTCAGAACCCC
GCCGTCGCAGATATGGAAGAACAACTACCTGCAACAAGCGAGCAGTTCAGTCTGAGCATATCCTTATACATTCTC
GTCCAGGGGCTTATGCCGCTGGTGTGGTGTGCCATAAGTGAGATAAAAGGCAGAAAAATGATATACCTGGTCTCA
TTGGCGGGCTCTCTTGTTTCTTCCATCGCTGTGGCGGTTAGTAGACGTATTGAGTTGGTTATAGCCTTTCGTTCA
ATCCAGGCCGCAGGATTGAGTGCCGTGATTTCCATTGGGGCGGCGACCCTTGCTGATATGTTCGAACCTGCTGAA
CGGGGAACAAAGATGGGAGTTTATTATATGGCGCCTTTACTTGGTCCGGCACTCGGACCCATCATTGGTGGCGCG
CTAACATCAGGCCTGGGCTGGAGGTCGATTTTCTGGTTTTTGACCATCGTTGCTGGCGCGATATGGATGGCCTTC
CTATTATTTTTCCGTGATACATTCAGAAAGGAAAGAAGTCTAACGTATCAGACTGTTCTCAAGCAACATGCCATT
GCTCGGGCAAAAAATGATATTGGTCACGAGGCTGCCCTGCCGCGCACCCCCGCACCCGCAAGCACTCACAATGTA
CATGGAGATGTAGAAAAGGGTAAAGAAGCAATGGGTAAAGAAGACGCTGATGCTCTCGCCGTTCCAGCCGCTCAA
ATTGAGTTGACATTGAGAGATGTCAACCCAATTTCACCTCTCCTGGCCGTGGTACGGCGCATAAACAATTTGCTT
ATCTTGACCGCATCCGGTCTCATGTATGCACTTACCTACATGATCAACTACACGGGAGCACGAACACTCAGCAAT
GACTATCATTACGATGCGTTGATGATTGGCGTAATAACCATTGCATATGGTTTAGGGTGTGTGGCAGGCAGTATC
TTGGGAGGCCGCTGGTCTGACTATAAATTATCCCAACTGAAAAAGGCTAACGGAGGAATAGGTTATCCCGAGATG
AGACTGAAAAGTACCACAATCGGTTTGATAATATTCCCTCCGAGTGTCGTCGGGTTCGGTTGGGCATGTAGAGAA
CATACCCATGTTGCCGTTCTCTGCGTACTGCTGTTCGTTGCCGGTTTTTTCACTATATGGGTATATTCAAGCACA
TTAGCTTATGTTGTCGATGCTAATAAGGGTAGATCTGCAACTGCCGTTGCGACTAACTCTGCATTCCGCGGCACG
CTTGCTTTTATCGCGACCGAGATCGCTGTACCTATGCAGGATGGCATTGGAGATGGCTGGCTATACACTTTCTGG
GGGTTCCTCATGGCTCTGAGTGGTTTATTAATACTGCTCGTGTCGTGGAAAGGCAGGGATTGGAGGATACGCGCT
GAAGAGCGTGAAGCAAAAGCGACTGGTATGGAATCTCACTGA
Transcript >AgabiH97|098910
ATGAATATGACCTTAAGTGACGCAGAGAAAACCACCGAAATACCTCAAAATAGCCCCTCAGATCGGCGAGACTCT
ATCGACACCGCAGAAACTGCAGTGGACATAGAACATGTTCCAGTTCAAGACGATCCCCGTAGTTGGTCGTGGTTA
CGAAAGCATTTCAGTTTATTTCTGATATCGGGGGCCGCAATGATTGCTGGTTTCGCCGGTACGATTCAGAACCCC
GCCGTCGCAGATATGGAAGAACAACTACCTGCAACAAGCGAGCAGTTCAGTCTGAGCATATCCTTATACATTCTC
GTCCAGGGGCTTATGCCGCTGGTGTGGTGTGCCATAAGTGAGATAAAAGGCAGAAAAATGATATACCTGGTCTCA
TTGGCGGGCTCTCTTGTTTCTTCCATCGCTGTGGCGGTTAGTAGACGTATTGAGTTGGTTATAGCCTTTCGTTCA
ATCCAGGCCGCAGGATTGAGTGCCGTGATTTCCATTGGGGCGGCGACCCTTGCTGATATGTTCGAACCTGCTGAA
CGGGGAACAAAGATGGGAGTTTATTATATGGCGCCTTTACTTGGTCCGGCACTCGGACCCATCATTGGTGGCGCG
CTAACATCAGGCCTGGGCTGGAGGTCGATTTTCTGGTTTTTGACCATCGTTGCTGGCGCGATATGGATGGCCTTC
CTATTATTTTTCCGTGATACATTCAGAAAGGAAAGAAGTCTAACGTATCAGACTGTTCTCAAGCAACATGCCATT
GCTCGGGCAAAAAATGATATTGGTCACGAGGCTGCCCTGCCGCGCACCCCCGCACCCGCAAGCACTCACAATGTA
CATGGAGATGTAGAAAAGGGTAAAGAAGCAATGGGTAAAGAAGACGCTGATGCTCTCGCCGTTCCAGCCGCTCAA
ATTGAGTTGACATTGAGAGATGTCAACCCAATTTCACCTCTCCTGGCCGTGGTACGGCGCATAAACAATTTGCTT
ATCTTGACCGCATCCGGTCTCATGTATGCACTTACCTACATGATCAACTACACGGGAGCACGAACACTCAGCAAT
GACTATCATTACGATGCGTTGATGATTGGCGTAATAACCATTGCATATGGTTTAGGGTGTGTGGCAGGCAGTATC
TTGGGAGGCCGCTGGTCTGACTATAAATTATCCCAACTGAAAAAGGCTAACGGAGGAATAGGTTATCCCGAGATG
AGACTGAAAAGTACCACAATCGGTTTGATAATATTCCCTCCGAGTGTCGTCGGGTTCGGTTGGGCATGTAGAGAA
CATACCCATGTTGCCGTTCTCTGCGTACTGCTGTTCGTTGCCGGTTTTTTCACTATATGGGTATATTCAAGCACA
TTAGCTTATGTTGTCGATGCTAATAAGGGTAGATCTGCAACTGCCGTTGCGACTAACTCTGCATTCCGCGGCACG
CTTGCTTTTATCGCGACCGAGATCGCTGTACCTATGCAGGATGGCATTGGAGATGGCTGGCTATACACTTTCTGG
GGGTTCCTCATGGCTCTGAGTGGTTTATTAATACTGCTCGTGTCGTGGAAAGGCAGGGATTGGAGGATACGCGCT
GAAGAGCGTGAAGCAAAAGCGACTGGTATGGAATCTCACTGA
Gene >AgabiH97|098910
ATGAATATGACCTTAAGTGACGCAGAGAAAACCACCGAAATACCTCAAAATAGCCCCTCAGATCGGCGAGACTCT
ATCGACACCGCAGAAACTGCAGTGGACATAGAACATGTTCCAGTTCAAGACGATCCCCGTAGTTGGTCGTGGTTA
CGAAAGGTAATTGTCGAAACTCGACTTCTGCCTCGCATGTTGAGCACTCAAATCGATCCAAATGTTCTAGCATTT
CAGTTTATTTCTGATATCGGGGGCCGCAATGATTGCTGGTTTCGCCGGTACGATTCAGAACCGTAAGGAGCCGCC
GTGCGTGGAAGTGCTGTGAGATATTGATATATGTATCATGTTTAGCCGCCGTCGCAGATATGGAAGAACAACTAC
CTGCAACAAGCGAGCAGTTCAGTCTGAGCATATCCTTATACATTCTCGTCCAGGGGCTTATGCCGCTGGTGTGGT
GTGCCATAAGTGAGATAAAAGGCAGAAAAGTACGCTTTTCTTCCAGTTTATTTAGGACCGACTCGAACTGATTTT
CTGCACTTTAGATGATATACCTGGTCTCATTGGCGGGCTCTCTTGTTTCTTCCATCGCTGTGGCGGTTAGTAGAC
GTATTGAGTTGTGAGGGCATTCTGCTTTTTCTTGTTTTTGTGTTACCGATTCTGATACTCATCCCAGGGTTATAG
CCTTTCGTTCAATCCAGGCCGCAGGGTACGATGTACCACGATGATTGAGCGTGTTTTTCCTGAGCTGAGCCATAT
AGATTGAGTGCCGTGATTTCCATTGGGGCGGCGACCCTTGCTGATATGTTCGAACCTGCTGAACGGGGAACAAAG
GCATGTCTTTTGTTCTCATGATGAGTAATCCCGCTAACATGCCCAGTAGATGGGAGTTTATTATATGGCGCCTTT
ACTTGGTCCGGTGAGCATATATTCGATATTTTCGGCCGAAGTTGAAGAGTGATCCGACTGTGGCCCCTGACTTTG
TGGCACATGTTATATAGGCACTCGGACCCATCATTGGTGGCGCGCTAACATCAGGCCTGGGCTGGAGGTCGATTT
TCTGGTTTTTGACCATCGTTGCTGGCGCGATATGGATGGCCTTCCTATTATTTTTCCGTGATACATTCAGAAAGG
AAAGAAGTCTAACGTATCAGACTGTTCTCAAGCAACATGCCATTGCTCGGGCAAAAAATGATATTGGTCACGAGG
CTGCCCTGCCGCGCACCCCCGCACCCGCAAGCACTCACAATGTACATGGAGATGTAGAAAAGGGTAAAGAAGCAA
TGGGTAAAGAAGACGCTGATGCTCTCGCCGTTCCAGCCGCTCAAATTGAGTTGACATTGAGAGATGTCAACCCAA
TTTCACCTCTCCTGGCCGTGGTACGGCGCATAAACAATTTGCTTATCTTGACCGCATCCGGTAAAATACCATGAT
TCCCTGCGGCTTATTCGTGATTTTCTAACTTGCGCAAATGAAGGTCTCATGTATGCACTTACCTACATGATCAAC
TACACGGGAGCACGAACACTCAGCAATGACTATCATTACGATGCGTTGATGATTGGCGTAATAACCATTGCATAT
GGTTTAGGTATGCTTTCCTACTTTCGCAAGGATTCATGCTCATTGCTACAAATAACAGGGTGTGTGGCAGGCAGT
ATCTTGGGAGGCCGCTGGTCTGACTATAAATTATCCCAACTGAAAAAGGCTAACGGAGGAATAGGTTATCCCGAG
GTATGTCCGCCTTCTTGAACATGTCATTGGATATTCAGGGGCGAGAAACAGATGAGACTGAAAAGTACCACAATC
GGTTTGATAATATTCCCTCCGAGTGTCGTCGGGTTCGGTTGGGCATGTAGAGAACATACCCATGTTGCCGTTCTC
TGCGTACTGCTGTTCGTTGCCGGTTTTTTCACTATGCGAGTATACATGATCTTCCACCACTCTTATCTTATTTAT
GAATTGATTAGATGGGTATATTCAAGCACATTAGCTTATGTTGTCGATGCTAATAAGGGTAGATCTGCAACTGCC
GTTGCGACTAACTCTGCATTCCGCGGCACGCTTGCTTTTATCGCGACCGAGATCGCTGTACCTATGCAGGTGTGT
TGCACCTTCTAAATATATAATGAGTTTTGACTCACGCGACTTTATAGGATGGCATTGGAGATGGTAAGTGTTAGA
GTGATATCTCCTGTATTCGCGACATTCTCAGATTCATTAGGCTGGCTATACACTTTCTGGGGGTTCCTCATGGCT
CTGAGTGGTTTATTAATACTGCTCGTGTCGTGGAAAGGCAGGGATTGGAGGATACGCGCTGAAGAGCGTGAAGCA
AAAGCGACTGGTATGGAATCTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail