Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098890
Gene name
Locationscaffold_7:486125..488488
Strand+
Gene length (bp)2363
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05903 Peptidase_C97 PPPDE putative peptidase domain 2.2E-40 5 141
PF08324 PUL PUL domain 2.4E-38 327 617
PF00085 Thioredoxin Thioredoxin 4.5E-13 200 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 6 153 1.0E-42
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 6 150 6.0E-40
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 6 150 7.0E-40
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 6 150 7.0E-40
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 195 283 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 6 153 1.0E-42
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 6 150 6.0E-40
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 6 150 7.0E-40
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 6 150 7.0E-40
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 195 283 5.0E-11
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 191 301 6.0E-11
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 195 300 8.0E-11
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 217 300 6.0E-10
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 195 296 2.0E-09
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 218 304 2.0E-09
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 218 304 3.0E-09
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 218 304 8.0E-09
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 218 304 1.0E-08
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 186 310 1.0E-08
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 195 303 1.0E-08
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 218 304 2.0E-08
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 218 304 2.0E-08
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 218 304 2.0E-08
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 198 300 2.0E-08
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 218 301 3.0E-08
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 195 303 3.0E-08
sp|O64764|TRXO1_ARATH Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana GN=At2g35010 PE=2 SV=1 217 303 4.0E-08
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 218 304 4.0E-08
sp|Q9C9Y6|TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1 195 313 4.0E-08
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 202 300 6.0E-08
sp|Q6DC39|DESI2_DANRE Desumoylating isopeptidase 2 OS=Danio rerio GN=desi2 PE=2 SV=1 1 141 9.0E-08
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 218 300 1.0E-07
sp|Q93VQ9|TRXO2_ARATH Thioredoxin O2, mitochondrial OS=Arabidopsis thaliana GN=At1g31020 PE=2 SV=1 197 303 2.0E-07
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 218 300 2.0E-07
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 191 288 2.0E-07
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 218 304 2.0E-07
sp|Q5PQ09|DESI2_XENLA Desumoylating isopeptidase 2 OS=Xenopus laevis GN=desi2 PE=2 SV=1 32 141 3.0E-07
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 218 304 4.0E-07
sp|A3QRX8|DESI2_PIG Desumoylating isopeptidase 2 OS=Sus scrofa GN=DESI2 PE=2 SV=1 32 141 5.0E-07
sp|Q5R456|DESI2_PONAB Desumoylating isopeptidase 2 OS=Pongo abelii GN=DESI2 PE=2 SV=1 32 141 5.0E-07
sp|Q9D291|DESI2_MOUSE Desumoylating isopeptidase 2 OS=Mus musculus GN=Desi2 PE=1 SV=1 32 141 5.0E-07
sp|Q9BSY9|DESI2_HUMAN Desumoylating isopeptidase 2 OS=Homo sapiens GN=DESI2 PE=1 SV=1 32 141 5.0E-07
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 218 300 7.0E-07
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 218 300 8.0E-07
sp|Q5XIT6|DESI2_RAT Desumoylating isopeptidase 2 OS=Rattus norvegicus GN=Desi2 PE=2 SV=1 32 141 8.0E-07
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 218 299 1.0E-06
sp|Q655X0|TRXO_ORYSJ Thioredoxin O, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0665900 PE=2 SV=2 179 303 1.0E-06
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 198 303 1.0E-06
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 218 300 1.0E-06
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 218 300 1.0E-06
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 198 301 1.0E-06
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 218 296 2.0E-06
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 218 299 2.0E-06
sp|Q5ZIV7|DESI2_CHICK Desumoylating isopeptidase 2 OS=Gallus gallus GN=DESI2 PE=2 SV=1 32 141 2.0E-06
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 179 301 3.0E-06
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 199 291 3.0E-06
sp|Q93VG8|PPDEX_ARATH DeSI-like protein At4g17486 OS=Arabidopsis thaliana GN=At4g17486 PE=2 SV=1 4 126 3.0E-06
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 218 300 5.0E-06
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 218 304 5.0E-06
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 218 300 6.0E-06
sp|Q8X1T0|SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdu1 PE=1 SV=1 5 126 6.0E-06
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 198 297 7.0E-06
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 218 300 7.0E-06
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 218 300 7.0E-06
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 204 300 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 61.07 36.30 85.84
Initials Initials knots 70.96 42.57 99.36
Pileal_Stipeal_center Stage I stipe center 42.82 25.39 60.25
Pileal_Stipeal_shell Stage I stipe shell 37.03 21.71 52.34
DIF_stipe_center Stage II stipe center 38.67 23.03 54.31
DIF_stipe_shell Stage II stipe shell 31.39 18.48 44.30
DIF_stipe_skin Stage II stipe skin 39.62 23.36 55.88
DIF_cap_skin Stage II cap skin 29.64 17.33 41.96
DIF_cap_tissue Stage II cap tissue 25.48 14.84 36.13
DIF_gill_tissue Stage II gill tissue 27.54 16.05 39.03
YFB_stipe_center Young fruiting body stipe center 65.55 37.94 93.15
YFB_stipe_shell Young fruiting body stipe shell 46.99 28.04 65.94
YFB_stipe_skin Young fruiting body stipe skin 40.09 23.87 56.32
YFB_cap_skin Young fruiting body cap skin 33.22 19.68 46.75
YFB_cap_tissue Young fruiting body cap tissue 23.19 13.35 33.04
YFB_gill_tissue Young fruiting body gill tissue 45.07 26.69 63.45
YFB_veil Young fruiting body veil 39.38 23.12 55.64

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.002084 yes
Casing YFB_stipe_center 0.890188 no
Casing YFB_stipe_shell 0.444998 no
Casing YFB_stipe_skin 0.144028 no
Casing YFB_cap_skin 0.017783 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.345193 no
Casing YFB_veil 0.129827 no
Casing Initials 0.718572 no
Casing Pileal_Stipeal_center 0.247911 no
Casing Pileal_Stipeal_shell 0.070499 no
Casing DIF_stipe_center 0.105226 no
Casing DIF_stipe_shell 0.007782 yes
Casing DIF_stipe_skin 0.123805 no
Casing DIF_cap_skin 0.004548 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.053965 no
DIF_gill_tissue YFB_stipe_skin 0.215620 no
DIF_gill_tissue YFB_cap_skin 0.635725 no
DIF_gill_tissue YFB_cap_tissue 0.683494 no
DIF_gill_tissue YFB_gill_tissue 0.075382 no
DIF_gill_tissue YFB_veil 0.251119 no
YFB_stipe_center YFB_stipe_shell 0.306536 no
YFB_stipe_center YFB_stipe_skin 0.081756 no
YFB_stipe_center YFB_cap_skin 0.009446 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.221256 no
YFB_stipe_center YFB_veil 0.071226 no
YFB_stipe_shell YFB_stipe_skin 0.693832 no
YFB_stipe_shell YFB_cap_skin 0.257482 no
YFB_stipe_shell YFB_cap_tissue 0.004548 yes
YFB_stipe_shell YFB_gill_tissue 0.938090 no
YFB_stipe_shell YFB_veil 0.659591 no
YFB_stipe_skin YFB_cap_skin 0.623932 no
YFB_stipe_skin YFB_cap_tissue 0.049046 yes
YFB_stipe_skin YFB_gill_tissue 0.792399 no
YFB_stipe_skin YFB_veil 0.974349 no
YFB_cap_skin YFB_cap_tissue 0.258410 no
YFB_cap_skin YFB_gill_tissue 0.344582 no
YFB_cap_skin YFB_veil 0.675935 no
YFB_cap_tissue YFB_gill_tissue 0.014956 yes
YFB_cap_tissue YFB_veil 0.063183 no
YFB_gill_tissue YFB_veil 0.755160 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.871770 no
Initials YFB_stipe_shell 0.149625 no
Initials YFB_stipe_skin 0.030372 yes
Initials YFB_cap_skin 0.002084 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.095644 no
Initials YFB_veil 0.025963 yes
Initials Pileal_Stipeal_center 0.057945 no
Initials Pileal_Stipeal_shell 0.014081 yes
Initials DIF_stipe_center 0.023676 yes
Initials DIF_stipe_shell 0.001140 yes
Initials DIF_stipe_skin 0.022892 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.127200 no
Pileal_Stipeal_center YFB_stipe_center 0.146718 no
Pileal_Stipeal_center YFB_stipe_shell 0.843211 no
Pileal_Stipeal_center YFB_stipe_skin 0.895917 no
Pileal_Stipeal_center YFB_cap_skin 0.455107 no
Pileal_Stipeal_center YFB_cap_tissue 0.021056 yes
Pileal_Stipeal_center YFB_gill_tissue 0.922442 no
Pileal_Stipeal_center YFB_veil 0.863894 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.733195 no
Pileal_Stipeal_center DIF_stipe_center 0.826513 no
Pileal_Stipeal_center DIF_stipe_shell 0.330386 no
Pileal_Stipeal_center DIF_stipe_skin 0.875312 no
Pileal_Stipeal_center DIF_cap_skin 0.229034 no
Pileal_Stipeal_center DIF_cap_tissue 0.053150 no
Pileal_Stipeal_shell DIF_gill_tissue 0.383961 no
Pileal_Stipeal_shell YFB_stipe_center 0.038047 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.510212 no
Pileal_Stipeal_shell YFB_stipe_skin 0.874862 no
Pileal_Stipeal_shell YFB_cap_skin 0.816901 no
Pileal_Stipeal_shell YFB_cap_tissue 0.109622 no
Pileal_Stipeal_shell YFB_gill_tissue 0.611461 no
Pileal_Stipeal_shell YFB_veil 0.908349 no
Pileal_Stipeal_shell DIF_stipe_center 0.937451 no
Pileal_Stipeal_shell DIF_stipe_shell 0.689910 no
Pileal_Stipeal_shell DIF_stipe_skin 0.897193 no
Pileal_Stipeal_shell DIF_cap_skin 0.557529 no
Pileal_Stipeal_shell DIF_cap_tissue 0.226819 no
DIF_stipe_center DIF_gill_tissue 0.280063 no
DIF_stipe_center YFB_stipe_center 0.050294 no
DIF_stipe_center YFB_stipe_shell 0.602498 no
DIF_stipe_center YFB_stipe_skin 0.946572 no
DIF_stipe_center YFB_cap_skin 0.712150 no
DIF_stipe_center YFB_cap_tissue 0.066022 no
DIF_stipe_center YFB_gill_tissue 0.707773 no
DIF_stipe_center YFB_veil 0.973844 no
DIF_stipe_center DIF_stipe_shell 0.571988 no
DIF_stipe_center DIF_stipe_skin 0.964468 no
DIF_stipe_center DIF_cap_skin 0.437800 no
DIF_stipe_center DIF_cap_tissue 0.154660 no
DIF_stipe_shell DIF_gill_tissue 0.768731 no
DIF_stipe_shell YFB_stipe_center 0.002951 yes
DIF_stipe_shell YFB_stipe_shell 0.162495 no
DIF_stipe_shell YFB_stipe_skin 0.484085 no
DIF_stipe_shell YFB_cap_skin 0.913207 no
DIF_stipe_shell YFB_cap_tissue 0.367009 no
DIF_stipe_shell YFB_gill_tissue 0.227254 no
DIF_stipe_shell YFB_veil 0.533046 no
DIF_stipe_shell DIF_stipe_skin 0.512710 no
DIF_stipe_shell DIF_cap_skin 0.913475 no
DIF_stipe_shell DIF_cap_tissue 0.580192 no
DIF_stipe_skin DIF_gill_tissue 0.237553 no
DIF_stipe_skin YFB_stipe_center 0.072150 no
DIF_stipe_skin YFB_stipe_shell 0.665348 no
DIF_stipe_skin YFB_stipe_skin 0.982129 no
DIF_stipe_skin YFB_cap_skin 0.650762 no
DIF_stipe_skin YFB_cap_tissue 0.056367 no
DIF_stipe_skin YFB_gill_tissue 0.762607 no
DIF_stipe_skin YFB_veil 0.991079 no
DIF_stipe_skin DIF_cap_skin 0.381253 no
DIF_stipe_skin DIF_cap_tissue 0.127349 no
DIF_cap_skin DIF_gill_tissue 0.887128 no
DIF_cap_skin YFB_stipe_center 0.001625 yes
DIF_cap_skin YFB_stipe_shell 0.108995 no
DIF_cap_skin YFB_stipe_skin 0.357539 no
DIF_cap_skin YFB_cap_skin 0.803423 no
DIF_cap_skin YFB_cap_tissue 0.503143 no
DIF_cap_skin YFB_gill_tissue 0.148101 no
DIF_cap_skin YFB_veil 0.404591 no
DIF_cap_skin DIF_cap_tissue 0.723137 no
DIF_cap_tissue DIF_gill_tissue 0.879769 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.027698 yes
DIF_cap_tissue YFB_stipe_skin 0.117025 no
DIF_cap_tissue YFB_cap_skin 0.442326 no
DIF_cap_tissue YFB_cap_tissue 0.850733 no
DIF_cap_tissue YFB_gill_tissue 0.035765 yes
DIF_cap_tissue YFB_veil 0.141808 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098890
MSTTQVKLYVYDLSRGMASALSQQLTGRQINGIWHTSVVVFGKEIFYGQGITITRPGQSHHGQPMQIIDMGETAI
DEETFDEYLEDIRVHYTADKYHLLDFNCNSFTNDVVGFLTGGSIPTFIKDLPSDFLSTPFGAALRPTIDAMFRPP
VPGQAPVAPTSPAAASLLQSVADQAQAPTTTPSTSPGISSISAPMHVITNPASLNSFLKSHRAAAAFFTSQTCPP
CRMIEPIYERLAEEKSLRDGRQGVAFAKIDIGVGLGRSIAAEWNIRSTPTFYFFQDGKKKAELKGADAAELRTQI
DLLIYETYPPHPHTRLSLPILQKLSLKPILFSQQPPIDTVVSKLFASVDEASWPATANPTPDQIKNVISKGFVPY
LKSIGSPKNTNSVPVISNTAAMLATWSQATSALANALSAEVLFPLVDIWRLAFLDPSTANWAAAPSTTPSGGPIG
VVLPKAIDTLQSRSSKGARNFILTVLRLLCNSFSSPMLARRILTDGAVKPMMTSFIVASLLHDDGSVRTAAASLA
FNIGAWLQNSRIEAGKGVQGTNAVVEDDEWQVELVSAILEAFGRETSNEEVVHRLAAALGLLIRLSPFYDEQLKP
LLEILQARGTLKAKLGQGNGWEGDGGVKKREVRGLIEEIADKLCA*
Coding >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGT
ATTACTATCACAAGGCCAGGCCAATCCCATCATGGCCAACCGATGCAAATCATCGACATGGGCGAAACCGCCATT
GACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCGGATAAATACCATCTCCTAGAT
TTTAACTGCAATTCGTTTACCAATGACGTCGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGAT
CTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAACCATAGATGCCATGTTTAGGCCTCCA
GTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCTCCTTCAATCAGTGGCCGATCAAGCA
CAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATCCGCTCCAATGCATGTCATCACTAAT
CCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATTCTTTACCAGTCAAACTTGTCCTCCT
TGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTTACGTGATGGCCGCCAAGGAGTCGCG
TTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGAATGGAACATCCGGAGTACCCCTACA
TTCTATTTCTTCCAAGATGGTAAAAAAAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAAATC
GACCTACTTATCTACGAAACCTATCCTCCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCT
CTTAAACCGATTTTGTTTTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAA
GCATCGTGGCCCGCCACAGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATAC
CTCAAGTCAATTGGTTCGCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACA
TGGAGCCAGGCGACGTCAGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGG
CTCGCGTTCCTTGATCCATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGA
GTTGTCCTTCCAAAGGCCATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTG
CTGAGATTGCTGTGTAATTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCG
ATGATGACCTCGTTTATTGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCG
TTTAATATCGGAGCTTGGCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTG
GAAGATGACGAATGGCAGGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAA
GTTGTCCATCGCCTAGCGGCGGCGCTGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCC
TTGTTGGAGATTTTGCAAGCACGGGGAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGA
GGAGTGAAGAAGCGGGAAGTGCGAGGGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA
Transcript >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGT
ATTACTATCACAAGGCCAGGCCAATCCCATCATGGCCAACCGATGCAAATCATCGACATGGGCGAAACCGCCATT
GACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCGGATAAATACCATCTCCTAGAT
TTTAACTGCAATTCGTTTACCAATGACGTCGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGAT
CTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAACCATAGATGCCATGTTTAGGCCTCCA
GTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCTCCTTCAATCAGTGGCCGATCAAGCA
CAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATCCGCTCCAATGCATGTCATCACTAAT
CCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATTCTTTACCAGTCAAACTTGTCCTCCT
TGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTTACGTGATGGCCGCCAAGGAGTCGCG
TTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGAATGGAACATCCGGAGTACCCCTACA
TTCTATTTCTTCCAAGATGGTAAAAAAAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAAATC
GACCTACTTATCTACGAAACCTATCCTCCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCT
CTTAAACCGATTTTGTTTTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAA
GCATCGTGGCCCGCCACAGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATAC
CTCAAGTCAATTGGTTCGCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACA
TGGAGCCAGGCGACGTCAGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGG
CTCGCGTTCCTTGATCCATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGA
GTTGTCCTTCCAAAGGCCATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTG
CTGAGATTGCTGTGTAATTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCG
ATGATGACCTCGTTTATTGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCG
TTTAATATCGGAGCTTGGCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTG
GAAGATGACGAATGGCAGGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAA
GTTGTCCATCGCCTAGCGGCGGCGCTGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCC
TTGTTGGAGATTTTGCAAGCACGGGGAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGA
GGAGTGAAGAAGCGGGAAGTGCGAGGGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA
Gene >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGTATTTGCGAATCTGTCCTTGGTTTAGAACGGTACTGAGCATGATGTAG
GCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGTATTACTATCACAAGGCCAGGCCAATC
CCATGTGAGCCTCTTTGTATTTCATCACGAACCCCACTGACCGTTTGATAGCATGGCCAACCGATGCAAATCATC
GACATGGGCGAAACCGCCATTGACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCG
GATAAAGTACGCCATCCCTTCTTTGATCACGAACTCAACTGACTAGAACGCTATAGTACCATCTCCTAGGTCAAT
TTCTATCATCACGCCGTCTTTCATTCGTGCTCATCCGAATACAGATTTTAACTGCAATTCGTTTACCAATGACGT
CGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGGTACGCGCGTCTTTTTTTCAGTTCTAGGAAC
TTTGTTTGATCGATCATGGATAGATCTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAAC
CATAGATGCCATGTTTAGGCCTCCAGTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCT
CCTTCAATCAGTGGCCGATCAAGCACAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATC
CGCTCCAATGCATGTCATCACTAATCCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATT
CTTTACCAGTCAAACTTGTCCTCCTTGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTT
ACGTGATGGCCGCCAAGGAGTCGCGTTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGA
ATGGAACATCCGGAGTACCCCTACATTCTATTTCTTCCAAGATGGTAAAAAAGTGTGTGGTTTTCTCTGGTCAAC
TTACAAAACGGTCAATAATTATCATCATAGAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAA
ATCGACCTACTTATCTACGAAACCTATCCTCGTGAGTAGTACCTTGGTTCGATGATTATCCAGCGTGGCTTGACA
TTTCCCCATAGCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCTCTTAAACCGATTTTGTT
TTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAAGCATCGTGGCCCGCCAC
AGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATACCTCAAGTCAATTGGTTC
GCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACATGGAGCCAGGCGACGTC
AGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGGCTCGCGTTCCTTGATCC
ATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGAGTTGTCCTTCCAAAGGC
CATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTGCTGAGATTGCTGTGTAA
TTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCGATGATGACCTCGTTTAT
TGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCGTTTAATATCGGAGCTTG
GCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTGGAAGATGACGAATGGCA
GGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAAGTTGGTGAGCTGTCATT
TGCGTTTTTTCCATGTGGGTATATGTTTCTTAAAAATCAAACCACGGGACACAGTCCATCGCCTAGCGGCGGCGC
TGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCCTTGTTGGAGATTTTGCAAGCACGGG
GAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGAGGAGTGAAGAAGCGGGAAGTGCGAG
GGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail