Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098890
Gene name
Locationscaffold_7:486125..488488
Strand+
Gene length (bp)2363
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05903 Peptidase_C97 PPPDE putative peptidase domain 2.2E-40 5 141
PF08324 PUL PUL domain 2.4E-38 327 617
PF00085 Thioredoxin Thioredoxin 4.5E-13 200 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 6 153 1.0E-42
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 6 150 6.0E-40
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 6 150 7.0E-40
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 6 150 7.0E-40
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 195 283 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLM5|DESI1_XENLA Desumoylating isopeptidase 1 OS=Xenopus laevis GN=desi1 PE=2 SV=1 6 153 1.0E-42
sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens GN=DESI1 PE=1 SV=1 6 150 6.0E-40
sp|Q4KM30|DESI1_RAT Desumoylating isopeptidase 1 OS=Rattus norvegicus GN=Desi1 PE=2 SV=1 6 150 7.0E-40
sp|Q9CQT7|DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus GN=Desi1 PE=1 SV=1 6 150 7.0E-40
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 195 283 5.0E-11
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 191 301 6.0E-11
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 195 300 8.0E-11
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 217 300 6.0E-10
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 195 296 2.0E-09
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 218 304 2.0E-09
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 218 304 3.0E-09
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 218 304 8.0E-09
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 218 304 1.0E-08
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 186 310 1.0E-08
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 195 303 1.0E-08
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 218 304 2.0E-08
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 218 304 2.0E-08
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 218 304 2.0E-08
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 198 300 2.0E-08
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 218 301 3.0E-08
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 195 303 3.0E-08
sp|O64764|TRXO1_ARATH Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana GN=At2g35010 PE=2 SV=1 217 303 4.0E-08
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 218 304 4.0E-08
sp|Q9C9Y6|TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1 195 313 4.0E-08
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 202 300 6.0E-08
sp|Q6DC39|DESI2_DANRE Desumoylating isopeptidase 2 OS=Danio rerio GN=desi2 PE=2 SV=1 1 141 9.0E-08
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 218 300 1.0E-07
sp|Q93VQ9|TRXO2_ARATH Thioredoxin O2, mitochondrial OS=Arabidopsis thaliana GN=At1g31020 PE=2 SV=1 197 303 2.0E-07
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 218 300 2.0E-07
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 191 288 2.0E-07
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 218 304 2.0E-07
sp|Q5PQ09|DESI2_XENLA Desumoylating isopeptidase 2 OS=Xenopus laevis GN=desi2 PE=2 SV=1 32 141 3.0E-07
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 218 304 4.0E-07
sp|A3QRX8|DESI2_PIG Desumoylating isopeptidase 2 OS=Sus scrofa GN=DESI2 PE=2 SV=1 32 141 5.0E-07
sp|Q5R456|DESI2_PONAB Desumoylating isopeptidase 2 OS=Pongo abelii GN=DESI2 PE=2 SV=1 32 141 5.0E-07
sp|Q9D291|DESI2_MOUSE Desumoylating isopeptidase 2 OS=Mus musculus GN=Desi2 PE=1 SV=1 32 141 5.0E-07
sp|Q9BSY9|DESI2_HUMAN Desumoylating isopeptidase 2 OS=Homo sapiens GN=DESI2 PE=1 SV=1 32 141 5.0E-07
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 218 300 7.0E-07
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 218 300 8.0E-07
sp|Q5XIT6|DESI2_RAT Desumoylating isopeptidase 2 OS=Rattus norvegicus GN=Desi2 PE=2 SV=1 32 141 8.0E-07
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 218 299 1.0E-06
sp|Q655X0|TRXO_ORYSJ Thioredoxin O, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0665900 PE=2 SV=2 179 303 1.0E-06
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 198 303 1.0E-06
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 218 300 1.0E-06
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 218 300 1.0E-06
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 198 301 1.0E-06
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 218 296 2.0E-06
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 218 299 2.0E-06
sp|Q5ZIV7|DESI2_CHICK Desumoylating isopeptidase 2 OS=Gallus gallus GN=DESI2 PE=2 SV=1 32 141 2.0E-06
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 179 301 3.0E-06
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 199 291 3.0E-06
sp|Q93VG8|PPDEX_ARATH DeSI-like protein At4g17486 OS=Arabidopsis thaliana GN=At4g17486 PE=2 SV=1 4 126 3.0E-06
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 218 300 5.0E-06
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 218 304 5.0E-06
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 218 300 6.0E-06
sp|Q8X1T0|SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdu1 PE=1 SV=1 5 126 6.0E-06
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 198 297 7.0E-06
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 218 300 7.0E-06
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 218 300 7.0E-06
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 204 300 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098890
MSTTQVKLYVYDLSRGMASALSQQLTGRQINGIWHTSVVVFGKEIFYGQGITITRPGQSHHGQPMQIIDMGETAI
DEETFDEYLEDIRVHYTADKYHLLDFNCNSFTNDVVGFLTGGSIPTFIKDLPSDFLSTPFGAALRPTIDAMFRPP
VPGQAPVAPTSPAAASLLQSVADQAQAPTTTPSTSPGISSISAPMHVITNPASLNSFLKSHRAAAAFFTSQTCPP
CRMIEPIYERLAEEKSLRDGRQGVAFAKIDIGVGLGRSIAAEWNIRSTPTFYFFQDGKKKAELKGADAAELRTQI
DLLIYETYPPHPHTRLSLPILQKLSLKPILFSQQPPIDTVVSKLFASVDEASWPATANPTPDQIKNVISKGFVPY
LKSIGSPKNTNSVPVISNTAAMLATWSQATSALANALSAEVLFPLVDIWRLAFLDPSTANWAAAPSTTPSGGPIG
VVLPKAIDTLQSRSSKGARNFILTVLRLLCNSFSSPMLARRILTDGAVKPMMTSFIVASLLHDDGSVRTAAASLA
FNIGAWLQNSRIEAGKGVQGTNAVVEDDEWQVELVSAILEAFGRETSNEEVVHRLAAALGLLIRLSPFYDEQLKP
LLEILQARGTLKAKLGQGNGWEGDGGVKKREVRGLIEEIADKLCA*
Coding >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGT
ATTACTATCACAAGGCCAGGCCAATCCCATCATGGCCAACCGATGCAAATCATCGACATGGGCGAAACCGCCATT
GACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCGGATAAATACCATCTCCTAGAT
TTTAACTGCAATTCGTTTACCAATGACGTCGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGAT
CTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAACCATAGATGCCATGTTTAGGCCTCCA
GTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCTCCTTCAATCAGTGGCCGATCAAGCA
CAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATCCGCTCCAATGCATGTCATCACTAAT
CCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATTCTTTACCAGTCAAACTTGTCCTCCT
TGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTTACGTGATGGCCGCCAAGGAGTCGCG
TTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGAATGGAACATCCGGAGTACCCCTACA
TTCTATTTCTTCCAAGATGGTAAAAAAAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAAATC
GACCTACTTATCTACGAAACCTATCCTCCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCT
CTTAAACCGATTTTGTTTTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAA
GCATCGTGGCCCGCCACAGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATAC
CTCAAGTCAATTGGTTCGCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACA
TGGAGCCAGGCGACGTCAGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGG
CTCGCGTTCCTTGATCCATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGA
GTTGTCCTTCCAAAGGCCATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTG
CTGAGATTGCTGTGTAATTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCG
ATGATGACCTCGTTTATTGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCG
TTTAATATCGGAGCTTGGCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTG
GAAGATGACGAATGGCAGGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAA
GTTGTCCATCGCCTAGCGGCGGCGCTGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCC
TTGTTGGAGATTTTGCAAGCACGGGGAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGA
GGAGTGAAGAAGCGGGAAGTGCGAGGGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA
Transcript >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGT
ATTACTATCACAAGGCCAGGCCAATCCCATCATGGCCAACCGATGCAAATCATCGACATGGGCGAAACCGCCATT
GACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCGGATAAATACCATCTCCTAGAT
TTTAACTGCAATTCGTTTACCAATGACGTCGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGAT
CTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAACCATAGATGCCATGTTTAGGCCTCCA
GTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCTCCTTCAATCAGTGGCCGATCAAGCA
CAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATCCGCTCCAATGCATGTCATCACTAAT
CCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATTCTTTACCAGTCAAACTTGTCCTCCT
TGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTTACGTGATGGCCGCCAAGGAGTCGCG
TTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGAATGGAACATCCGGAGTACCCCTACA
TTCTATTTCTTCCAAGATGGTAAAAAAAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAAATC
GACCTACTTATCTACGAAACCTATCCTCCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCT
CTTAAACCGATTTTGTTTTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAA
GCATCGTGGCCCGCCACAGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATAC
CTCAAGTCAATTGGTTCGCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACA
TGGAGCCAGGCGACGTCAGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGG
CTCGCGTTCCTTGATCCATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGA
GTTGTCCTTCCAAAGGCCATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTG
CTGAGATTGCTGTGTAATTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCG
ATGATGACCTCGTTTATTGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCG
TTTAATATCGGAGCTTGGCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTG
GAAGATGACGAATGGCAGGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAA
GTTGTCCATCGCCTAGCGGCGGCGCTGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCC
TTGTTGGAGATTTTGCAAGCACGGGGAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGA
GGAGTGAAGAAGCGGGAAGTGCGAGGGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA
Gene >AgabiH97|098890
ATGTCGACTACGCAAGTCAAGCTGTATGTCTACGATCTCAGCCGTGGAATGGCAAGTGCTCTCTCTCAACAACTT
ACCGGACGGCAGATAAACGGCATCTGGTATTTGCGAATCTGTCCTTGGTTTAGAACGGTACTGAGCATGATGTAG
GCATACTTCTGTTGTGGTCTTTGGGAAAGAGATCTTTTATGGACAAGGTATTACTATCACAAGGCCAGGCCAATC
CCATGTGAGCCTCTTTGTATTTCATCACGAACCCCACTGACCGTTTGATAGCATGGCCAACCGATGCAAATCATC
GACATGGGCGAAACCGCCATTGACGAGGAGACGTTTGATGAATATTTAGAAGATATTAGAGTTCATTATACCGCG
GATAAAGTACGCCATCCCTTCTTTGATCACGAACTCAACTGACTAGAACGCTATAGTACCATCTCCTAGGTCAAT
TTCTATCATCACGCCGTCTTTCATTCGTGCTCATCCGAATACAGATTTTAACTGCAATTCGTTTACCAATGACGT
CGTAGGCTTTCTTACTGGAGGATCAATACCCACCTTCATCAAAGGTACGCGCGTCTTTTTTTCAGTTCTAGGAAC
TTTGTTTGATCGATCATGGATAGATCTTCCTAGTGACTTTTTGTCCACGCCTTTCGGAGCCGCTCTTCGTCCAAC
CATAGATGCCATGTTTAGGCCTCCAGTCCCAGGCCAAGCACCTGTCGCTCCCACCTCCCCAGCCGCAGCGTCTCT
CCTTCAATCAGTGGCCGATCAAGCACAGGCTCCAACAACAACTCCCTCCACTTCCCCTGGAATATCCTCAATATC
CGCTCCAATGCATGTCATCACTAATCCCGCATCCTTAAATTCATTTCTCAAATCTCACCGAGCGGCCGCGGCATT
CTTTACCAGTCAAACTTGTCCTCCTTGCCGAATGATTGAACCTATTTACGAGAGACTGGCCGAGGAGAAGAGTTT
ACGTGATGGCCGCCAAGGAGTCGCGTTCGCCAAGATTGATATTGGTGTTGGTCTTGGCAGGAGCATCGCAGCGGA
ATGGAACATCCGGAGTACCCCTACATTCTATTTCTTCCAAGATGGTAAAAAAGTGTGTGGTTTTCTCTGGTCAAC
TTACAAAACGGTCAATAATTATCATCATAGAAAGCCGAACTAAAGGGCGCGGATGCAGCGGAGCTCAGGACACAA
ATCGACCTACTTATCTACGAAACCTATCCTCGTGAGTAGTACCTTGGTTCGATGATTATCCAGCGTGGCTTGACA
TTTCCCCATAGCGCATCCCCACACCCGACTTAGCCTTCCGATACTCCAGAAACTCTCTCTTAAACCGATTTTGTT
TTCTCAGCAGCCTCCGATTGATACAGTGGTCTCCAAGCTATTCGCCTCCGTCGACGAAGCATCGTGGCCCGCCAC
AGCCAATCCTACCCCAGACCAAATCAAGAATGTCATTTCAAAGGGTTTTGTTCCATACCTCAAGTCAATTGGTTC
GCCAAAAAACACGAATTCAGTGCCGGTGATTTCAAATACGGCAGCCATGCTAGCGACATGGAGCCAGGCGACGTC
AGCTCTCGCTAATGCGCTCTCTGCGGAAGTGCTTTTCCCCTTGGTTGACATTTGGCGGCTCGCGTTCCTTGATCC
ATCTACGGCTAATTGGGCTGCGGCCCCATCAACAACCCCATCTGGAGGTCCTATCGGAGTTGTCCTTCCAAAGGC
CATTGACACATTGCAGTCTAGATCTTCCAAGGGGGCAAGAAATTTCATCCTGACTGTGCTGAGATTGCTGTGTAA
TTCGTTCTCGAGCCCTATGTTGGCTCGGAGAATTCTGACAGATGGTGCTGTCAAGCCGATGATGACCTCGTTTAT
TGTTGCGAGTTTGTTGCATGATGATGGGTCTGTGAGGACTGCGGCTGCTAGCCTGGCGTTTAATATCGGAGCTTG
GCTTCAGAATAGTAGGATAGAGGCGGGGAAGGGGGTTCAAGGGACTAATGCTGTCGTGGAAGATGACGAATGGCA
GGTTGAACTTGTCAGTGCTATTCTTGAAGCCTTCGGTCGGGAGACTAGTAACGAAGAAGTTGGTGAGCTGTCATT
TGCGTTTTTTCCATGTGGGTATATGTTTCTTAAAAATCAAACCACGGGACACAGTCCATCGCCTAGCGGCGGCGC
TGGGGCTGTTGATTCGACTGTCACCGTTCTATGATGAACAGTTGAAACCCTTGTTGGAGATTTTGCAAGCACGGG
GAACACTCAAGGCCAAACTTGGTCAAGGCAACGGTTGGGAGGGTGATGGAGGAGTGAAGAAGCGGGAAGTGCGAG
GGCTGATTGAAGAGATTGCGGATAAACTCTGTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail