Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098710
Gene name
Locationscaffold_7:433234..433546
Strand-
Gene length (bp)312
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.506 0.4927 0.0443 0.0772 0.2199 0.0649 0.0969 0.1568 0.1271 0.0332

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup85
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|291900
Agaricus bisporus var bisporus H97 AgabiH97|039720
Agaricus bisporus var bisporus H97 AgabiH97|086810
Agaricus bisporus var bisporus H97 AgabiH97|089510
Agaricus bisporus var bisporus H97 AgabiH97|098710 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|107800
Rhodonia placenta FPRL280 RhoplFPRL280|1232_2
Rhodonia placenta FPRL280 RhoplFPRL280|1518_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098710
MSEARKAPSYRHQTQVEENVDIKEVLTRLFGKEVTLTQQELLAMAPKLREMWKDVISKRRVPTSTNLFDEAEVEE
DTLLDAETAELETWDVVDPMLLEAPKKV*
Coding >AgabiH97|098710
ATGTCTGAAGCTAGAAAGGCTCCGAGCTATCGACATCAGACTCAAGTAGAAGAAAATGTTGATATTAAGGAAGTT
TTAACTAGGCTATTTGGAAAGGAGGTCACCTTGACGCAGCAAGAGCTATTAGCAATGGCTCCCAAGCTTAGAGAA
ATGTGGAAAGATGTAATCAGTAAAAGACGGGTACCTACCAGTACTAATCTTTTTGACGAAGCAGAAGTCGAAGAG
GATACACTCCTTGACGCAGAAACAGCGGAGCTAGAGACATGGGATGTAGTAGATCCTATGTTACTCGAAGCACCT
AAGAAAGTTTGA
Transcript >AgabiH97|098710
ATGTCTGAAGCTAGAAAGGCTCCGAGCTATCGACATCAGACTCAAGTAGAAGAAAATGTTGATATTAAGGAAGTT
TTAACTAGGCTATTTGGAAAGGAGGTCACCTTGACGCAGCAAGAGCTATTAGCAATGGCTCCCAAGCTTAGAGAA
ATGTGGAAAGATGTAATCAGTAAAAGACGGGTACCTACCAGTACTAATCTTTTTGACGAAGCAGAAGTCGAAGAG
GATACACTCCTTGACGCAGAAACAGCGGAGCTAGAGACATGGGATGTAGTAGATCCTATGTTACTCGAAGCACCT
AAGAAAGTTTGA
Gene >AgabiH97|098710
ATGTCTGAAGCTAGAAAGGCTCCGAGCTATCGACATCAGACTCAAGTAGAAGAAAATGTTGATATTAAGGAAGTT
TTAACTAGGCTATTTGGAAAGGAGGTCACCTTGACGCAGCAAGAGCTATTAGCAATGGCTCCCAAGCTTAGAGAA
ATGTGGAAAGATGTAATCAGTAAAAGACGGGTACCTACCAGTACTAATCTTTTTGACGAAGCAGAAGTCGAAGAG
GATACACTCCTTGACGCAGAAACAGCGGAGCTAGAGACATGGGATGTAGTAGATCCTATGTTACTCGAAGCACCT
AAGAAAGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail