Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098130
Gene name
Locationscaffold_7:260806..263254
Strand+
Gene length (bp)2448
Transcript length (bp)2355
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32334|MSB2_YEAST Signaling mucin MSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB2 PE=1 SV=1 518 618 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 672 694 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098130
MRLLFLFYAVLPIYAARRSHSTRLTRRQGLLGQLVPGILGPDTPPTTSILDPVTVFPSSSSSSIPTPTPDGGLLG
DLTSAAGGLVSNVGGVVSTVGSDLGGAVSTVGSDLGGIIGGSPSSTPTASPPTNTGDPTPSSSDGGLLGGLTSVV
GGVLDPPSPSTTAPPPSDTPPAPTPTSSSDGGLLGGLTSVVGGVLDPPSPSTTAPPPSDTPPTPTSSSDGGLLGG
VTSVVGGVISDVGGAVSTIGSDVGGVLNPPSPSTTPPAPPSSPSQTQPPTPTSSSDGGLLGGVTSIVGGLTSDVG
GIISTVTSGLGGVVGTPTSAPVNTTPISNPGSSSGGIIDTLTSGIGGVITTVTSDIGGVIPTSISSVDPNPPVTD
GPSGNATSTTTSGTVEPTDVTSPNITSSAQPTISFPTQTTNVSTSSTTLSTTQTSTEIMTTVTTTTSTTLSVASD
LSFVLEESTLAFASLPTTTPSVTFTDPDQATPTAPQPVTTLVAPPLPSGIPGWIYPRQRLNSSNSDLEGFTLISI
LFNKELNWMFEIQDPISASQIFVYMPMLISTALRIPSDQVKTFALRVYIPDTYHSPNDAAQLGTLYLGYIPNDLI
DPLSAQIKVKSSAFYTQGPDDNSRALAQRVVPSYSLLSVSPNDDPGSGGSSDDSGNNNGSSDSGKTREEAIIGVV
SALGSIALLVLGFLVYRSYKRRQQLAHRRLSDPPGENLGVRPQGREFDQDSVGGARRRSFYYAEDSLRGYESQPA
PNDQLMAESSMSQRRNVVPGSISAPVLRGSTMNW*
Coding >AgabiH97|098130
ATGCGTCTCCTTTTTCTCTTCTACGCCGTCCTCCCTATTTATGCGGCCCGCCGCTCCCACTCCACCCGCCTCACC
CGTCGCCAGGGCCTCCTTGGCCAGCTCGTGCCTGGCATTCTCGGCCCAGACACACCACCCACCACCAGCATTCTC
GATCCAGTCACCGTATTTCCTTCCTCGTCCTCATCGTCTATTCCCACCCCCACCCCCGATGGCGGTCTCCTCGGC
GATCTCACTAGTGCCGCTGGCGGTCTCGTCAGCAACGTCGGTGGTGTAGTCAGTACAGTCGGTAGCGACCTCGGA
GGCGCCGTCAGTACCGTGGGCAGCGACCTCGGTGGCATTATCGGCGGTTCCCCTTCCAGCACTCCCACGGCCAGT
CCTCCCACCAATACCGGCGATCCTACTCCTTCAAGTTCTGACGGTGGTCTTCTCGGCGGCCTTACTAGTGTCGTG
GGTGGTGTTCTTGATCCTCCTAGTCCTTCTACTACTGCACCACCCCCTTCCGACACGCCCCCTGCGCCTACGCCG
ACGTCCAGCTCTGACGGCGGTCTTCTTGGCGGTCTCACCAGCGTCGTGGGTGGTGTTCTTGATCCTCCTAGTCCT
TCCACTACTGCACCACCACCTTCCGATACGCCCCCTACGCCTACGTCCAGCTCTGACGGTGGTCTTCTTGGCGGT
GTCACTAGCGTCGTTGGTGGAGTCATCAGCGATGTCGGTGGCGCTGTGAGTACCATTGGTAGCGATGTCGGCGGT
GTCCTCAATCCTCCTAGTCCTTCCACCACTCCACCAGCCCCTCCTTCCAGTCCTTCACAGACTCAGCCCCCTACG
CCTACGTCCAGCTCTGACGGCGGTCTTCTCGGCGGTGTCACAAGTATTGTTGGTGGACTCACGAGTGATGTCGGT
GGCATAATCAGTACCGTCACCAGCGGCCTTGGAGGTGTTGTTGGCACTCCGACCAGCGCTCCCGTCAATACTACC
CCAATCAGTAATCCTGGTTCTTCCTCTGGTGGTATCATTGATACCTTGACCAGCGGCATTGGTGGTGTTATCACC
ACAGTAACTAGCGATATCGGTGGTGTCATCCCCACCTCAATCAGCAGTGTGGACCCGAACCCTCCCGTTACTGAT
GGTCCAAGTGGGAATGCCACCAGTACAACAACCTCAGGTACTGTCGAACCCACCGATGTAACATCCCCGAACATT
ACCAGCTCTGCACAACCGACGATCAGCTTCCCCACACAGACGACCAATGTCTCAACCTCCTCTACCACCCTTTCT
ACGACTCAAACGTCGACGGAAATCATGACTACCGTGACTACAACCACGTCCACCACCTTGTCCGTCGCGTCTGAT
CTCTCCTTTGTCCTTGAAGAGTCTACCCTCGCGTTTGCCTCGCTTCCCACCACCACTCCCTCTGTCACTTTCACA
GACCCAGATCAAGCAACGCCGACCGCTCCCCAACCTGTTACCACTCTTGTCGCTCCCCCCCTTCCCTCCGGTATC
CCTGGTTGGATATACCCTCGCCAACGGCTGAATTCAAGCAACAGTGACCTCGAGGGATTTACCTTGATCAGTATT
CTCTTCAACAAGGAACTCAATTGGATGTTTGAAATTCAGGATCCCATCTCGGCCAGCCAAATTTTCGTTTACATG
CCCATGTTGATCAGCACCGCGCTACGCATCCCATCTGATCAAGTCAAGACCTTTGCTTTGCGAGTCTATATTCCA
GATACCTACCATAGTCCCAATGATGCCGCTCAGCTTGGAACCCTTTATCTCGGCTACATACCCAATGATTTAATC
GATCCCCTCTCTGCTCAAATCAAAGTCAAGTCGTCAGCTTTCTACACCCAAGGTCCAGACGACAATTCTCGAGCC
CTTGCTCAGCGTGTCGTTCCCTCTTATTCACTGCTTTCCGTCTCACCCAATGACGACCCCGGATCCGGCGGTTCG
TCCGATGATTCCGGCAACAATAACGGTTCATCCGACAGTGGCAAGACCCGCGAGGAGGCCATCATTGGTGTCGTC
AGTGCCCTCGGTTCTATCGCCCTTCTTGTTCTCGGTTTCCTCGTCTATCGGTCGTATAAACGCCGTCAACAACTC
GCTCACCGCCGTCTGTCTGATCCTCCCGGCGAGAATCTTGGTGTACGCCCTCAGGGACGCGAATTTGACCAGGAT
AGTGTCGGCGGTGCGAGACGGAGAAGTTTCTATTACGCGGAAGACTCTTTGCGTGGATATGAATCCCAGCCGGCG
CCTAACGACCAGCTCATGGCTGAGAGTAGCATGAGTCAGAGGAGGAATGTCGTTCCAGGCTCGATCTCCGCTCCC
GTTTTAAGGGGCAGTACGATGAACTGGTAG
Transcript >AgabiH97|098130
ATGCGTCTCCTTTTTCTCTTCTACGCCGTCCTCCCTATTTATGCGGCCCGCCGCTCCCACTCCACCCGCCTCACC
CGTCGCCAGGGCCTCCTTGGCCAGCTCGTGCCTGGCATTCTCGGCCCAGACACACCACCCACCACCAGCATTCTC
GATCCAGTCACCGTATTTCCTTCCTCGTCCTCATCGTCTATTCCCACCCCCACCCCCGATGGCGGTCTCCTCGGC
GATCTCACTAGTGCCGCTGGCGGTCTCGTCAGCAACGTCGGTGGTGTAGTCAGTACAGTCGGTAGCGACCTCGGA
GGCGCCGTCAGTACCGTGGGCAGCGACCTCGGTGGCATTATCGGCGGTTCCCCTTCCAGCACTCCCACGGCCAGT
CCTCCCACCAATACCGGCGATCCTACTCCTTCAAGTTCTGACGGTGGTCTTCTCGGCGGCCTTACTAGTGTCGTG
GGTGGTGTTCTTGATCCTCCTAGTCCTTCTACTACTGCACCACCCCCTTCCGACACGCCCCCTGCGCCTACGCCG
ACGTCCAGCTCTGACGGCGGTCTTCTTGGCGGTCTCACCAGCGTCGTGGGTGGTGTTCTTGATCCTCCTAGTCCT
TCCACTACTGCACCACCACCTTCCGATACGCCCCCTACGCCTACGTCCAGCTCTGACGGTGGTCTTCTTGGCGGT
GTCACTAGCGTCGTTGGTGGAGTCATCAGCGATGTCGGTGGCGCTGTGAGTACCATTGGTAGCGATGTCGGCGGT
GTCCTCAATCCTCCTAGTCCTTCCACCACTCCACCAGCCCCTCCTTCCAGTCCTTCACAGACTCAGCCCCCTACG
CCTACGTCCAGCTCTGACGGCGGTCTTCTCGGCGGTGTCACAAGTATTGTTGGTGGACTCACGAGTGATGTCGGT
GGCATAATCAGTACCGTCACCAGCGGCCTTGGAGGTGTTGTTGGCACTCCGACCAGCGCTCCCGTCAATACTACC
CCAATCAGTAATCCTGGTTCTTCCTCTGGTGGTATCATTGATACCTTGACCAGCGGCATTGGTGGTGTTATCACC
ACAGTAACTAGCGATATCGGTGGTGTCATCCCCACCTCAATCAGCAGTGTGGACCCGAACCCTCCCGTTACTGAT
GGTCCAAGTGGGAATGCCACCAGTACAACAACCTCAGGTACTGTCGAACCCACCGATGTAACATCCCCGAACATT
ACCAGCTCTGCACAACCGACGATCAGCTTCCCCACACAGACGACCAATGTCTCAACCTCCTCTACCACCCTTTCT
ACGACTCAAACGTCGACGGAAATCATGACTACCGTGACTACAACCACGTCCACCACCTTGTCCGTCGCGTCTGAT
CTCTCCTTTGTCCTTGAAGAGTCTACCCTCGCGTTTGCCTCGCTTCCCACCACCACTCCCTCTGTCACTTTCACA
GACCCAGATCAAGCAACGCCGACCGCTCCCCAACCTGTTACCACTCTTGTCGCTCCCCCCCTTCCCTCCGGTATC
CCTGGTTGGATATACCCTCGCCAACGGCTGAATTCAAGCAACAGTGACCTCGAGGGATTTACCTTGATCAGTATT
CTCTTCAACAAGGAACTCAATTGGATGTTTGAAATTCAGGATCCCATCTCGGCCAGCCAAATTTTCGTTTACATG
CCCATGTTGATCAGCACCGCGCTACGCATCCCATCTGATCAAGTCAAGACCTTTGCTTTGCGAGTCTATATTCCA
GATACCTACCATAGTCCCAATGATGCCGCTCAGCTTGGAACCCTTTATCTCGGCTACATACCCAATGATTTAATC
GATCCCCTCTCTGCTCAAATCAAAGTCAAGTCGTCAGCTTTCTACACCCAAGGTCCAGACGACAATTCTCGAGCC
CTTGCTCAGCGTGTCGTTCCCTCTTATTCACTGCTTTCCGTCTCACCCAATGACGACCCCGGATCCGGCGGTTCG
TCCGATGATTCCGGCAACAATAACGGTTCATCCGACAGTGGCAAGACCCGCGAGGAGGCCATCATTGGTGTCGTC
AGTGCCCTCGGTTCTATCGCCCTTCTTGTTCTCGGTTTCCTCGTCTATCGGTCGTATAAACGCCGTCAACAACTC
GCTCACCGCCGTCTGTCTGATCCTCCCGGCGAGAATCTTGGTGTACGCCCTCAGGGACGCGAATTTGACCAGGAT
AGTGTCGGCGGTGCGAGACGGAGAAGTTTCTATTACGCGGAAGACTCTTTGCGTGGATATGAATCCCAGCCGGCG
CCTAACGACCAGCTCATGGCTGAGAGTAGCATGAGTCAGAGGAGGAATGTCGTTCCAGGCTCGATCTCCGCTCCC
GTTTTAAGGGGCAGTACGATGAACTGGTAG
Gene >AgabiH97|098130
ATGCGTCTCCTTTTTCTCTTCTACGCCGTCCTCCCTATTTATGCGGCCCGCCGCTCCCACTCCACCCGCCTCACC
CGTCGCCAGGGCCTCCTTGGCCAGCTCGTGCCTGGCATTCTCGGTTTGTTCTTTCTTTTGTCGTTGTTCTTGTGC
TCATTCGTACAGGCCCAGACACACCACCCACCACCAGCATTCTCGATCCAGTCACCGTATTTCCTTCCTCGTCCT
CATCGTCTATTCCCACCCCCACCCCCGATGGCGGTCTCCTCGGCGATCTCACTAGTGCCGCTGGCGGTCTCGTCA
GCAACGTCGGTGGTGTAGTCAGTACAGTCGGTAGCGACCTCGGAGGCGCCGTCAGTACCGTGGGCAGCGACCTCG
GTGGCATTATCGGCGGTTCCCCTTCCAGCACTCCCACGGCCAGTCCTCCCACCAATACCGGCGATCCTACTCCTT
CAAGTTCTGACGGTGGTCTTCTCGGCGGCCTTACTAGTGTCGTGGGTGGTGTTCTTGATCCTCCTAGTCCTTCTA
CTACTGCACCACCCCCTTCCGACACGCCCCCTGCGCCTACGCCGACGTCCAGCTCTGACGGCGGTCTTCTTGGCG
GTCTCACCAGCGTCGTGGGTGGTGTTCTTGATCCTCCTAGTCCTTCCACTACTGCACCACCACCTTCCGATACGC
CCCCTACGCCTACGTCCAGCTCTGACGGTGGTCTTCTTGGCGGTGTCACTAGCGTCGTTGGTGGAGTCATCAGCG
ATGTCGGTGGCGCTGTGAGTACCATTGGTAGCGATGTCGGCGGTGTCCTCAATCCTCCTAGTCCTTCCACCACTC
CACCAGCCCCTCCTTCCAGTCCTTCACAGACTCAGCCCCCTACGCCTACGTCCAGCTCTGACGGCGGTCTTCTCG
GCGGTGTCACAAGTATTGTTGGTGGACTCACGAGTGATGTCGGTGGCATAATCAGTACCGTCACCAGCGGCCTTG
GAGGTGTTGTTGGCACTCCGACCAGCGCTCCCGTCAATACTACCCCAATCAGTAATCCTGGTTCTTCCTCTGGTG
GTATCATTGATACCTTGACCAGCGGCATTGGTGGTGTTATCACCACAGTAACTAGCGATATCGGTGGTGTCATCC
CCACCTCAATCAGCAGTGTGGACCCGAACCCTCCCGTTACTGATGGTCCAAGTGGGAATGCCACCAGTACAACAA
CCTCAGGTACTGTCGAACCCACCGATGTAACATCCCCGAACATTACCAGCTCTGCACAACCGACGATCAGCTTCC
CCACACAGACGACCAATGTCTCAACCTCCTCTACCACCCTTTCTACGACTCAAACGTCGACGGAAATCATGACTA
CCGTGACTACAACCACGTCCACCACCTTGTCCGTCGCGTCTGATCTCTCCTTTGTCCTTGAAGAGTCTACCCTCG
CGTTTGCCTCGCTTCCCACCACCACTCCCTCTGTCACTTTCACAGACCCAGATCAAGCAACGCCGACCGCTCCCC
AACCTGTTACCACTCTTGTCGCTCCCCCCCTTCCCTCCGGTATCCCTGGTTGGATATACCCTCGCCAACGGCTGA
ATTCAAGCAACAGTGACCTCGAGGGATTTACCTTGATCAGTATTCTCTTCAACAAGGAACTCAATTGGATGTTTG
AAATTCAGGATCCCATCTCGGCCAGCCAAATTTTCGTTTACATGCCCATGTTGATCAGCACCGCGCTACGCATCC
CATGTGAGCCCCTCTTTTGTTGTCGTTGCTTTTAATGCTCATCTATTTTTAGCTGATCAAGTCAAGACCTTTGCT
TTGCGAGTCTATATTCCAGATACCTACCATAGTCCCAATGATGCCGCTCAGCTTGGAACCCTTTATCTCGGCTAC
ATACCCAATGATTTAATCGATCCCCTCTCTGCTCAAATCAAAGTCAAGTCGTCAGCTTTCTACACCCAAGGTCCA
GACGACAATTCTCGAGCCCTTGCTCAGCGTGTCGTTCCCTCTTATTCACTGCTTTCCGTCTCACCCAATGACGAC
CCCGGATCCGGCGGTTCGTCCGATGATTCCGGCAACAATAACGGTTCATCCGACAGTGGCAAGACCCGCGAGGAG
GCCATCATTGGTGTCGTCAGTGCCCTCGGTTCTATCGCCCTTCTTGTTCTCGGTTTCCTCGTCTATCGGTCGTAT
AAACGCCGTCAACAACTCGCTCACCGCCGTCTGTCTGATCCTCCCGGCGAGAATCTTGGTGTACGCCCTCAGGGA
CGCGAATTTGACCAGGATAGTGTCGGCGGTGCGAGACGGAGAAGTTTCTATTACGCGGAAGACTCTTTGCGTGGA
TATGAATCCCAGCCGGCGCCTAACGACCAGCTCATGGCTGAGAGTAGCATGAGTCAGAGGAGGAATGTCGTTCCA
GGCTCGATCTCCGCTCCCGTTTTAAGGGGCAGTACGATGAACTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail