Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098120
Gene name
Locationscaffold_7:259744..260653
Strand+
Gene length (bp)909
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03939 Ribosomal_L23eN Ribosomal protein L23, N-terminal domain 1.7E-23 56 104
PF00276 Ribosomal_L23 Ribosomal protein L23 2.6E-16 113 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51997|RL25_PUCGR 60S ribosomal protein L25 OS=Puccinia graminis PE=2 SV=2 36 193 2.0E-64
sp|O74391|RL25B_SCHPO 60S ribosomal protein L25-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2502 PE=3 SV=1 57 193 3.0E-58
sp|Q10330|RL25A_SCHPO 60S ribosomal protein L25-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2501 PE=1 SV=1 57 193 2.0E-57
sp|P62752|RL23A_RAT 60S ribosomal protein L23a OS=Rattus norvegicus GN=Rpl23a PE=2 SV=1 68 193 3.0E-55
sp|P62751|RL23A_MOUSE 60S ribosomal protein L23a OS=Mus musculus GN=Rpl23a PE=1 SV=1 68 193 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51997|RL25_PUCGR 60S ribosomal protein L25 OS=Puccinia graminis PE=2 SV=2 36 193 2.0E-64
sp|O74391|RL25B_SCHPO 60S ribosomal protein L25-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2502 PE=3 SV=1 57 193 3.0E-58
sp|Q10330|RL25A_SCHPO 60S ribosomal protein L25-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2501 PE=1 SV=1 57 193 2.0E-57
sp|P62752|RL23A_RAT 60S ribosomal protein L23a OS=Rattus norvegicus GN=Rpl23a PE=2 SV=1 68 193 3.0E-55
sp|P62751|RL23A_MOUSE 60S ribosomal protein L23a OS=Mus musculus GN=Rpl23a PE=1 SV=1 68 193 3.0E-55
sp|P62750|RL23A_HUMAN 60S ribosomal protein L23a OS=Homo sapiens GN=RPL23A PE=1 SV=1 68 193 3.0E-55
sp|Q24JY1|RL23A_BOVIN 60S ribosomal protein L23a OS=Bos taurus GN=RPL23A PE=2 SV=1 68 193 3.0E-55
sp|P08792|RL25_CYBJA 60S ribosomal protein L25 OS=Cyberlindnera jadinii GN=RPL25 PE=3 SV=1 57 193 3.0E-54
sp|P48045|RL25_KLULA 60S ribosomal protein L25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPL25 PE=3 SV=1 57 193 1.0E-51
sp|P48162|R23A1_CAEEL 60S ribosomal protein L23a 1 OS=Caenorhabditis elegans GN=rpl-25.1 PE=3 SV=1 48 193 4.0E-49
sp|P04456|RL25_YEAST 60S ribosomal protein L25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL25 PE=1 SV=4 68 193 1.0E-46
sp|Q20647|R23A2_CAEEL 60S ribosomal protein L23a 2 OS=Caenorhabditis elegans GN=rpl-25.2 PE=3 SV=1 51 193 4.0E-45
sp|Q9AT35|RL23A_DAUCA 60S ribosomal protein L23a OS=Daucus carota GN=RPL23A PE=2 SV=1 55 193 3.0E-44
sp|Q9M3C3|R23A2_ARATH 60S ribosomal protein L23a-2 OS=Arabidopsis thaliana GN=RPL23AB PE=2 SV=1 74 193 3.0E-43
sp|O22644|RL23A_FRIAG 60S ribosomal protein L23A OS=Fritillaria agrestis GN=RPL23A PE=2 SV=1 48 193 3.0E-43
sp|Q54BQ3|RL23A_DICDI 60S ribosomal protein L23a OS=Dictyostelium discoideum GN=rpl23a PE=1 SV=1 68 193 4.0E-42
sp|Q8LD46|R23A1_ARATH 60S ribosomal protein L23a-1 OS=Arabidopsis thaliana GN=RPL23AA PE=2 SV=2 78 193 4.0E-40
sp|Q07761|RL23A_TOBAC 60S ribosomal protein L23a OS=Nicotiana tabacum GN=RPL23A PE=2 SV=1 74 193 3.0E-39
sp|P0DJ57|RL23A_TETTS 60S ribosomal protein L23A OS=Tetrahymena thermophila (strain SB210) GN=RPL23A PE=1 SV=1 56 193 7.0E-34
sp|P41165|RL23A_TRYBB 60S ribosomal protein L23a OS=Trypanosoma brucei brucei GN=RPL23A PE=2 SV=1 73 193 8.0E-34
sp|Q9LWB5|RK23_SPIOL 50S ribosomal protein L23, chloroplastic OS=Spinacia oleracea GN=RPL23 PE=1 SV=1 106 193 2.0E-21
sp|Q5JDH1|RL23_THEKO 50S ribosomal protein L23P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl23p PE=3 SV=1 108 193 8.0E-20
sp|Q8U000|RL23_PYRFU 50S ribosomal protein L23P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl23p PE=1 SV=2 108 193 8.0E-20
sp|P54016|RL23_METJA 50S ribosomal protein L23P OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl23p PE=3 SV=1 108 191 2.0E-19
sp|O74095|RL23_PYRHO 50S ribosomal protein L23P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl23p PE=3 SV=1 108 193 3.0E-19
sp|A6UV66|RL23_META3 50S ribosomal protein L23P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl23p PE=3 SV=1 108 191 6.0E-19
sp|Q9V1T7|RL23_PYRAB 50S ribosomal protein L23P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl23p PE=3 SV=1 108 193 1.0E-18
sp|B6YSL5|RL23_THEON 50S ribosomal protein L23P OS=Thermococcus onnurineus (strain NA1) GN=rpl23p PE=3 SV=1 108 193 1.0E-18
sp|C5A284|RL23_THEGJ 50S ribosomal protein L23P OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl23p PE=3 SV=1 108 193 3.0E-18
sp|P10143|RL23_METVS 50S ribosomal protein L23P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl23p PE=1 SV=1 108 191 3.0E-17
sp|A4FVY0|RL23_METM5 50S ribosomal protein L23P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl23p PE=3 SV=1 108 191 4.0E-17
sp|A9A9B6|RL23_METM6 50S ribosomal protein L23P OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl23p PE=3 SV=1 108 191 6.0E-17
sp|Q8TY92|RL23_METKA 50S ribosomal protein L23P OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl23p PE=3 SV=1 104 193 6.0E-17
sp|C6A161|RL23_THESM 50S ribosomal protein L23P OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl23p PE=3 SV=1 108 193 7.0E-17
sp|A6VHD4|RL23_METM7 50S ribosomal protein L23P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl23p PE=3 SV=1 108 191 9.0E-17
sp|A3DNA6|RL23_STAMF 50S ribosomal protein L23P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl23p PE=3 SV=1 108 193 3.0E-16
sp|Q6LX09|RL23_METMP 50S ribosomal protein L23P OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl23p PE=3 SV=1 108 191 7.0E-16
sp|Q4JB42|RL23_SULAC 50S ribosomal protein L23P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl23p PE=3 SV=1 118 193 1.0E-15
sp|Q06842|RL23_HALSA 50S ribosomal protein L23P OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl23p PE=1 SV=3 117 191 1.0E-15
sp|Q8ZW50|RL23_PYRAE 50S ribosomal protein L23P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl23p PE=3 SV=1 120 193 1.0E-15
sp|Q9YFM0|RL23_AERPE 50S ribosomal protein L23P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl23p PE=3 SV=2 114 191 9.0E-15
sp|P12732|RL23_HALMA 50S ribosomal protein L23P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl23p PE=1 SV=2 111 193 8.0E-14
sp|Q975I3|RL23_SULTO 50S ribosomal protein L23P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl23p PE=3 SV=1 118 193 4.0E-13
sp|O28356|RL23_ARCFU 50S ribosomal protein L23P OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl23p PE=3 SV=1 118 191 8.0E-13
sp|A5UL87|RL23_METS3 50S ribosomal protein L23P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl23p PE=3 SV=1 108 191 1.0E-12
sp|Q3IMY6|RL23_NATPD 50S ribosomal protein L23P OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl23p PE=3 SV=1 113 191 1.0E-12
sp|O26112|RL23_METTH 50S ribosomal protein L23P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl23p PE=3 SV=2 108 191 4.0E-12
sp|A8MB73|RL23_CALMQ 50S ribosomal protein L23P OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl23p PE=3 SV=1 120 193 2.0E-11
sp|Q18GF1|RL23_HALWD 50S ribosomal protein L23P OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl23p PE=3 SV=1 114 191 2.0E-11
sp|Q2NFV8|RL23_METST 50S ribosomal protein L23P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl23p PE=3 SV=1 108 191 3.0E-11
sp|Q97ZQ4|RL23_SULSO 50S ribosomal protein L23P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl23p PE=3 SV=1 118 193 3.0E-10
sp|Q2IXQ8|RL23_RHOP2 50S ribosomal protein L23 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplW PE=3 SV=1 100 174 1.0E-09
sp|Q134T1|RL23_RHOPS 50S ribosomal protein L23 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplW PE=3 SV=1 100 174 4.0E-09
sp|Q6N4T7|RL23_RHOPA 50S ribosomal protein L23 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplW PE=1 SV=1 100 174 6.0E-09
sp|Q211F0|RL23_RHOPB 50S ribosomal protein L23 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplW PE=3 SV=1 106 174 1.0E-08
sp|Q89J86|RL23_BRADU 50S ribosomal protein L23 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplW PE=3 SV=1 103 174 1.0E-08
sp|Q46G97|RL23_METBF 50S ribosomal protein L23P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl23p PE=3 SV=1 117 193 1.0E-08
sp|Q6L1C5|RL23_PICTO 50S ribosomal protein L23P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl23p PE=3 SV=1 114 191 2.0E-08
sp|Q8PV48|RL23_METMA 50S ribosomal protein L23P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl23p PE=3 SV=1 113 193 2.0E-08
sp|Q8TRU5|RL23_METAC 50S ribosomal protein L23P OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl23p PE=3 SV=1 113 193 3.0E-08
sp|B1ZLK6|RL23_METPB 50S ribosomal protein L23 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplW PE=3 SV=1 106 174 3.0E-08
sp|B1LWS8|RL23_METRJ 50S ribosomal protein L23 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplW PE=3 SV=1 106 174 5.0E-08
sp|Q1QN28|RL23_NITHX 50S ribosomal protein L23 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplW PE=3 SV=1 110 174 6.0E-08
sp|B2V7L1|RL23_SULSY 50S ribosomal protein L23 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplW PE=3 SV=1 111 174 6.0E-08
sp|Q12ZU9|RL23_METBU 50S ribosomal protein L23P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl23p PE=3 SV=1 117 193 6.0E-08
sp|Q3SSW4|RL23_NITWN 50S ribosomal protein L23 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplW PE=3 SV=1 109 174 8.0E-08
sp|Q74N77|RL23_NANEQ 50S ribosomal protein L23P OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl23p PE=3 SV=1 118 191 1.0E-07
sp|Q8EK66|RL23_SHEON 50S ribosomal protein L23 OS=Shewanella oneidensis (strain MR-1) GN=rplW PE=3 SV=2 112 182 1.0E-07
sp|A0LIJ2|RL23_SYNFM 50S ribosomal protein L23 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplW PE=3 SV=1 111 182 1.0E-07
sp|Q2FU93|RL23_METHJ 50S ribosomal protein L23P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl23p PE=3 SV=1 117 193 2.0E-07
sp|Q0I0A3|RL23_SHESR 50S ribosomal protein L23 OS=Shewanella sp. (strain MR-7) GN=rplW PE=3 SV=2 112 182 2.0E-07
sp|Q0HNT5|RL23_SHESM 50S ribosomal protein L23 OS=Shewanella sp. (strain MR-4) GN=rplW PE=3 SV=2 112 182 2.0E-07
sp|Q1AU31|RL23_RUBXD 50S ribosomal protein L23 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplW PE=3 SV=1 108 176 3.0E-07
sp|Q5FTY5|RL23_GLUOX 50S ribosomal protein L23 OS=Gluconobacter oxydans (strain 621H) GN=rplW PE=3 SV=2 111 191 3.0E-07
sp|A9W4Q3|RL23_METEP 50S ribosomal protein L23 OS=Methylobacterium extorquens (strain PA1) GN=rplW PE=3 SV=1 106 174 3.0E-07
sp|B7L0R3|RL23_METC4 50S ribosomal protein L23 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplW PE=3 SV=1 106 174 3.0E-07
sp|B2A4E1|RL23_NATTJ 50S ribosomal protein L23 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplW PE=3 SV=1 108 186 4.0E-07
sp|C5CC60|RL23_MICLC 50S ribosomal protein L23 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplW PE=3 SV=1 101 172 4.0E-07
sp|A5GAW7|RL23_GEOUR 50S ribosomal protein L23 OS=Geobacter uraniireducens (strain Rf4) GN=rplW PE=3 SV=1 108 177 5.0E-07
sp|Q9ZI48|RL23_AQUPY 50S ribosomal protein L23 OS=Aquifex pyrophilus GN=rplW PE=3 SV=1 111 177 6.0E-07
sp|B1YGV2|RL23_EXIS2 50S ribosomal protein L23 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplW PE=3 SV=1 117 185 7.0E-07
sp|B5FG11|RL23_VIBFM 50S ribosomal protein L23 OS=Vibrio fischeri (strain MJ11) GN=rplW PE=3 SV=1 116 182 9.0E-07
sp|Q5E8B3|RL23_VIBF1 50S ribosomal protein L23 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplW PE=3 SV=1 116 182 9.0E-07
sp|Q97BX5|RL23_THEVO 50S ribosomal protein L23P OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl23p PE=3 SV=1 113 191 1.0E-06
sp|A1S220|RL23_SHEAM 50S ribosomal protein L23 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplW PE=3 SV=1 112 182 2.0E-06
sp|Q9Z9L2|RL23_BACHD 50S ribosomal protein L23 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplW PE=3 SV=1 135 185 2.0E-06
sp|C3PKQ4|RL23_CORA7 50S ribosomal protein L23 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rplW PE=3 SV=1 114 186 2.0E-06
sp|Q0BUP8|RL23_GRABC 50S ribosomal protein L23 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplW PE=3 SV=1 99 190 3.0E-06
sp|B8IS87|RL23_METNO 50S ribosomal protein L23 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplW PE=3 SV=1 106 174 4.0E-06
sp|Q6F7R4|RL23_ACIAD 50S ribosomal protein L23 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplW PE=3 SV=1 111 182 4.0E-06
sp|Q3A9R8|RL23_CARHZ 50S ribosomal protein L23 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplW PE=3 SV=1 114 179 4.0E-06
sp|C1CP90|RL23_STRZT 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|C1CI99|RL23_STRZP 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain P1031) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|C1CC08|RL23_STRZJ 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain JJA) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|Q8CWV6|RL23_STRR6 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|B2IS42|RL23_STRPS 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|Q97SV3|RL23_STRPN 50S ribosomal protein L23 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|B8ZKF9|RL23_STRPJ 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|B1I8K0|RL23_STRPI 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|C1CAL4|RL23_STRP7 50S ribosomal protein L23 OS=Streptococcus pneumoniae (strain 70585) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|B5E6F7|RL23_STRP4 50S ribosomal protein L23 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|Q04MN4|RL23_STRP2 50S ribosomal protein L23 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplW PE=3 SV=1 108 186 4.0E-06
sp|Q9HIR1|RL23_THEAC 50S ribosomal protein L23P OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl23p PE=3 SV=1 114 191 4.0E-06
sp|A8AZM3|RL23_STRGC 50S ribosomal protein L23 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplW PE=3 SV=1 108 186 5.0E-06
sp|Q6LVB4|RL23_PHOPR 50S ribosomal protein L23 OS=Photobacterium profundum GN=rplW PE=3 SV=1 116 188 5.0E-06
sp|B0UHW7|RL23_METS4 50S ribosomal protein L23 OS=Methylobacterium sp. (strain 4-46) GN=rplW PE=3 SV=1 111 174 5.0E-06
sp|Q30Z44|RL23_DESAG 50S ribosomal protein L23 OS=Desulfovibrio alaskensis (strain G20) GN=rplW PE=3 SV=1 108 185 5.0E-06
sp|Q5WLR0|RL23_BACSK 50S ribosomal protein L23 OS=Bacillus clausii (strain KSM-K16) GN=rplW PE=3 SV=1 108 185 5.0E-06
sp|Q8NT06|RL23_CORGL 50S ribosomal protein L23 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplW PE=3 SV=1 114 188 6.0E-06
sp|A4QBI2|RL23_CORGB 50S ribosomal protein L23 OS=Corynebacterium glutamicum (strain R) GN=rplW PE=3 SV=1 114 188 6.0E-06
sp|Q0AUI2|RL23_SYNWW 50S ribosomal protein L23 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplW PE=3 SV=1 108 164 7.0E-06
sp|O66433|RL23_AQUAE 50S ribosomal protein L23 OS=Aquifex aeolicus (strain VF5) GN=rplW PE=3 SV=1 111 174 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098120
MPSSVKGRWGRVHTPRIDDDSTQTSVGIPSLLLQDMATTKTTKGKAAAKSAASKDNKAKAAKKAALQGAHSHSSR
KTRTSVSFHRPKTLRLPREPKYERKSINHAPRMDQYRTIVSPLNTESAMKKIEEHNTLVFIVDVRANKRQIKDAV
KKLYDVDAAKVNTLIRPDGKKKAYVRLTADADALDVANKIGFI*
Coding >AgabiH97|098120
ATGCCGAGTTCCGTAAAAGGAAGGTGGGGCCGTGTACACACGCCGAGGATTGACGACGACAGTACCCAAACCTCC
GTCGGCATACCCTCTCTCCTCCTTCAAGACATGGCTACGACGAAAACTACCAAGGGCAAGGCTGCCGCCAAGAGT
GCAGCATCGAAGGATAACAAGGCCAAGGCGGCGAAAAAGGCAGCGCTTCAAGGTGCTCACTCGCATAGCTCACGA
AAAACGCGCACGTCGGTGTCGTTCCACCGTCCCAAGACGCTGAGGTTGCCTCGTGAACCCAAGTATGAACGGAAA
TCGATCAACCATGCGCCTCGCATGGATCAGTACCGGACTATTGTCTCTCCACTCAATACGGAGTCTGCGATGAAG
AAGATTGAGGAGCACAATACGCTGGTGTTTATTGTGGATGTGAGGGCGAACAAGCGTCAGATCAAGGACGCGGTG
AAAAAGCTGTATGATGTGGATGCGGCCAAGGTGAACACGCTGATCCGACCTGATGGGAAGAAGAAGGCGTATGTG
CGGTTGACGGCAGACGCGGATGCGCTGGATGTGGCGAACAAGATTGGATTCATTTAG
Transcript >AgabiH97|098120
ATGCCGAGTTCCGTAAAAGGAAGGTGGGGCCGTGTACACACGCCGAGGATTGACGACGACAGTACCCAAACCTCC
GTCGGCATACCCTCTCTCCTCCTTCAAGACATGGCTACGACGAAAACTACCAAGGGCAAGGCTGCCGCCAAGAGT
GCAGCATCGAAGGATAACAAGGCCAAGGCGGCGAAAAAGGCAGCGCTTCAAGGTGCTCACTCGCATAGCTCACGA
AAAACGCGCACGTCGGTGTCGTTCCACCGTCCCAAGACGCTGAGGTTGCCTCGTGAACCCAAGTATGAACGGAAA
TCGATCAACCATGCGCCTCGCATGGATCAGTACCGGACTATTGTCTCTCCACTCAATACGGAGTCTGCGATGAAG
AAGATTGAGGAGCACAATACGCTGGTGTTTATTGTGGATGTGAGGGCGAACAAGCGTCAGATCAAGGACGCGGTG
AAAAAGCTGTATGATGTGGATGCGGCCAAGGTGAACACGCTGATCCGACCTGATGGGAAGAAGAAGGCGTATGTG
CGGTTGACGGCAGACGCGGATGCGCTGGATGTGGCGAACAAGATTGGATTCATTTAG
Gene >AgabiH97|098120
ATGCCGAGTTCCGTAAAAGGAAGGTGGGGCCGTGTACACACGCCGAGGATTGACGACGACAGTACCCAAACCTCC
GTCGGCATACCCTCTCTCCTCCTTCAAGGTGAGTAATTTATGCCCAGATTATGAATGATGTGCGGTTGCAGGACG
TGTTTGGCGTGGATTTGGAGGATAGTGGATGGATTGGTGGGATGGATGCGTGGATGCGGTTTTGGATGATGATGC
CGCTTTTTGTTGGGTTCTCATAATTTACAATTGAATGCTGACTTGGTTTTATAGACATGGCTACGACGAAAACTA
CCAAGGGCAAGGCTGCCGCCAAGAGTGGTGTGTTCATTGTTTTGAAATGATGGGGGGGGAGTATTAATGGGTTGT
AGCAGCATCGAAGGATAACAAGGCCAAGGCGGCGAAAAAGGCAGCGCTTCAAGGTGCTCACTCGCATAGCTCACG
AAAAACGCGCACGTCGGTGTCGTTCCACCGTCCCAAGACGCTGAGGTTGCCTCGTGAACCCAAGTATGAACGGAA
ATCGATCAACCATGCGCCTCGCATGGATCAGTACCGGACTATTGTCTCGTGAGTGGTTGTGGTGTTTTTTGATTA
TTGTGAAGTCTGAGGATGGTTAGTCCACTCAATACGGAGTCTGCGATGAAGAAGATTGAGGAGCACAATACGCTG
GTGTTTATTGTGGATGTGAGGGCGAACAAGCGTCAGATCAAGGACGCGGTGAAAAAGCTGTATGATGTGGATGCG
GCCAAGGTGAACACGCTGATCCGACCTGATGGGAAGAAGAAGGCGTATGTGCGGTTGACGGCAGACGCGGATGCG
CTGGATGTGGCGAACAAGGTCAGTGAATTGTGTGATGTATGCTAACGTGTGTCTAATATTCGATGGTAGATTGGA
TTCATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail