Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098080
Gene name
Locationscaffold_7:247595..249835
Strand+
Gene length (bp)2240
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.4E-47 50 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 492 8.0E-38
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 13 266 1.0E-33
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 7 257 4.0E-30
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 58 499 2.0E-29
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 2 496 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 492 8.0E-38
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 13 266 1.0E-33
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 7 257 4.0E-30
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 58 499 2.0E-29
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 2 496 4.0E-29
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 63 477 2.0E-28
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 5 465 1.0E-27
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 34 472 7.0E-27
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 3 492 5.0E-26
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 29 497 3.0E-25
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 31 470 4.0E-25
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 81 472 6.0E-25
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 12 427 3.0E-24
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 81 472 7.0E-23
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 22 471 2.0E-22
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 3 493 3.0E-22
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 2 470 1.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 1 475 2.0E-21
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 31 470 3.0E-21
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 2 492 4.0E-21
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 1 475 6.0E-21
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 30 470 7.0E-21
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 22 466 8.0E-21
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 3 497 2.0E-20
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 31 470 2.0E-19
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 56 487 1.0E-18
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 5 253 4.0E-18
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 10 440 5.0E-17
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 30 263 9.0E-17
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 30 263 9.0E-17
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 275 493 1.0E-16
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 15 440 7.0E-16
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 30 440 2.0E-15
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 60 224 5.0E-14
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 2 239 3.0E-12
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 84 483 3.0E-12
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 499 5.0E-11
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 6 462 1.0E-10
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 57 215 2.0E-10
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 57 215 2.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 283 493 4.0E-10
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 63 237 8.0E-10
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 63 199 5.0E-08
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 10 381 5.0E-08
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 33 196 6.0E-08
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 36 211 6.0E-08
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 118 246 6.0E-08
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 118 246 7.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 105 225 1.0E-07
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 63 201 1.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 62 230 1.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 17 226 2.0E-07
sp|D5B5U5|MDFA_YERPZ Multidrug transporter MdfA OS=Yersinia pestis (strain Z176003) GN=mdfA PE=3 SV=2 62 211 2.0E-07
sp|A9R4E0|MDFA_YERPG Multidrug transporter MdfA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdfA PE=3 SV=2 62 211 2.0E-07
sp|D0JKF6|MDFA_YERPD Multidrug transporter MdfA OS=Yersinia pestis (strain D106004) GN=mdfA PE=3 SV=2 62 211 2.0E-07
sp|D0JUX5|MDFA_YERP1 Multidrug transporter MdfA OS=Yersinia pestis (strain D182038) GN=mdfA PE=3 SV=2 62 211 2.0E-07
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 77 239 3.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 109 230 3.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 109 230 3.0E-07
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 68 244 9.0E-07
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 68 244 9.0E-07
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 33 226 2.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 33 226 2.0E-06
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 68 244 3.0E-06
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 68 244 6.0E-06
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 68 244 8.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 68 244 9.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 68 244 9.0E-06
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 68 244 1.0E-05
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 68 244 1.0E-05
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 68 244 1.0E-05
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 68 244 1.0E-05
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 68 244 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 79 101 22
3 108 130 22
4 134 156 22
5 168 190 22
6 195 217 22
7 289 311 22
8 326 348 22
9 369 391 22
10 396 418 22
11 430 452 22
12 462 481 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098080
MDQIESLPKNDAERQGVQSEVDIEHAPVANDPRKWSAVKKTTVLLLISSASMSVGIVAAIQNPAVKAMEQDLPAT
SDQFSLSLSLFVLVQGFMPIAWTSLGEIKGRKIVYLLALALSTVAAIAIALSPSIGLVIGFRCVQAMGSCAFLAV
GAATLADIYEPHKRGTKMGLYYTAPLLGPSLGPILGGGLTSGFGWRSIFWFCAIIGGICFAAFLLLFNDTFRKER
SLTYQAIVKQRQQKQTSENFELQSKSGHDFADANGDISPTPEIKITFRDVNPLKPIYLILRRWNNLAMLFATGIV
LAWQLTIVYTIARTLTSRYNYDAWKVGFTSLAYGVGALFGSVIGGRLSDRMLRRTMAENGGLIHPEVRLKSTMLS
MFFFPAFVIAGGWVTQAHAHIVAVIVILFGGGFFSVMMYSSMLAYIVDANVGRSSGAVAASTFFRGILAFTSLET
AVPMQEHLGDGWMYTIWGFIVSLSGILCIWTTYKGAEWRQRAEDRENKQAN*
Coding >AgabiH97|098080
ATGGACCAAATCGAATCACTCCCCAAAAACGATGCAGAAAGACAGGGGGTCCAGAGCGAGGTAGATATTGAACAC
GCTCCAGTGGCTAACGATCCGCGCAAGTGGTCGGCTGTGAAGAAGACAACAGTGTTGCTTTTGATTTCTTCAGCG
TCAATGAGTGTTGGAATAGTGGCTGCTATTCAGAATCCCGCGGTCAAAGCAATGGAGCAGGATCTTCCTGCAACT
AGCGACCAATTCAGTTTGAGTCTCTCGCTCTTTGTGCTTGTGCAAGGTTTCATGCCGATTGCGTGGACCTCTCTC
GGTGAGATCAAGGGTAGAAAAATTGTCTATTTACTGGCTCTAGCCCTCTCTACCGTCGCCGCTATCGCTATTGCT
CTAAGCCCATCCATCGGCCTTGTGATAGGATTCAGATGCGTCCAGGCAATGGGGTCATGCGCTTTCCTTGCAGTT
GGGGCCGCAACTCTTGCTGATATATACGAACCTCACAAACGCGGAACTAAGATGGGGCTATATTACACGGCGCCA
CTGCTTGGGCCATCACTTGGCCCTATTCTTGGAGGTGGATTGACTTCCGGATTTGGGTGGAGATCGATTTTCTGG
TTTTGTGCTATCATCGGCGGCATTTGTTTCGCTGCGTTTCTTCTCCTCTTCAACGACACCTTCAGGAAGGAAAGG
AGCTTGACATACCAGGCAATCGTGAAACAGCGGCAACAGAAACAGACATCCGAGAACTTTGAACTCCAGTCAAAG
TCGGGCCATGATTTTGCCGATGCTAACGGTGATATATCACCAACGCCGGAAATCAAGATCACTTTTCGAGACGTC
AATCCACTCAAACCGATTTATCTTATCCTTCGTCGGTGGAACAATTTGGCAATGCTTTTTGCAACTGGTATTGTC
CTCGCGTGGCAGCTGACCATTGTCTACACGATCGCGCGGACATTGACATCAAGGTATAATTACGATGCTTGGAAG
GTTGGTTTCACATCACTTGCTTATGGAGTTGGGGCTCTTTTCGGGAGTGTAATTGGAGGTAGATTGTCCGACCGC
ATGTTGCGTAGGACGATGGCGGAGAATGGCGGTCTAATTCATCCTGAAGTACGGTTGAAAAGCACGATGCTGAGT
ATGTTCTTCTTCCCTGCCTTTGTCATAGCAGGTGGTTGGGTAACCCAAGCCCATGCTCACATTGTTGCTGTCATC
GTGATACTCTTCGGTGGAGGCTTTTTTTCTGTCATGATGTATAGCAGTATGCTTGCCTACATTGTGGATGCTAAT
GTCGGAAGGTCTTCCGGGGCTGTCGCCGCGAGTACTTTCTTTCGTGGAATACTCGCATTCACCAGCCTTGAGACC
GCAGTTCCGATGCAGGAACATTTGGGTGATGGTTGGATGTACACCATCTGGGGCTTTATTGTTTCTCTTTCTGGC
ATTCTTTGCATCTGGACGACTTACAAAGGAGCTGAATGGAGGCAAAGAGCAGAAGATCGTGAAAACAAACAAGCT
AATTAA
Transcript >AgabiH97|098080
ATGGACCAAATCGAATCACTCCCCAAAAACGATGCAGAAAGACAGGGGGTCCAGAGCGAGGTAGATATTGAACAC
GCTCCAGTGGCTAACGATCCGCGCAAGTGGTCGGCTGTGAAGAAGACAACAGTGTTGCTTTTGATTTCTTCAGCG
TCAATGAGTGTTGGAATAGTGGCTGCTATTCAGAATCCCGCGGTCAAAGCAATGGAGCAGGATCTTCCTGCAACT
AGCGACCAATTCAGTTTGAGTCTCTCGCTCTTTGTGCTTGTGCAAGGTTTCATGCCGATTGCGTGGACCTCTCTC
GGTGAGATCAAGGGTAGAAAAATTGTCTATTTACTGGCTCTAGCCCTCTCTACCGTCGCCGCTATCGCTATTGCT
CTAAGCCCATCCATCGGCCTTGTGATAGGATTCAGATGCGTCCAGGCAATGGGGTCATGCGCTTTCCTTGCAGTT
GGGGCCGCAACTCTTGCTGATATATACGAACCTCACAAACGCGGAACTAAGATGGGGCTATATTACACGGCGCCA
CTGCTTGGGCCATCACTTGGCCCTATTCTTGGAGGTGGATTGACTTCCGGATTTGGGTGGAGATCGATTTTCTGG
TTTTGTGCTATCATCGGCGGCATTTGTTTCGCTGCGTTTCTTCTCCTCTTCAACGACACCTTCAGGAAGGAAAGG
AGCTTGACATACCAGGCAATCGTGAAACAGCGGCAACAGAAACAGACATCCGAGAACTTTGAACTCCAGTCAAAG
TCGGGCCATGATTTTGCCGATGCTAACGGTGATATATCACCAACGCCGGAAATCAAGATCACTTTTCGAGACGTC
AATCCACTCAAACCGATTTATCTTATCCTTCGTCGGTGGAACAATTTGGCAATGCTTTTTGCAACTGGTATTGTC
CTCGCGTGGCAGCTGACCATTGTCTACACGATCGCGCGGACATTGACATCAAGGTATAATTACGATGCTTGGAAG
GTTGGTTTCACATCACTTGCTTATGGAGTTGGGGCTCTTTTCGGGAGTGTAATTGGAGGTAGATTGTCCGACCGC
ATGTTGCGTAGGACGATGGCGGAGAATGGCGGTCTAATTCATCCTGAAGTACGGTTGAAAAGCACGATGCTGAGT
ATGTTCTTCTTCCCTGCCTTTGTCATAGCAGGTGGTTGGGTAACCCAAGCCCATGCTCACATTGTTGCTGTCATC
GTGATACTCTTCGGTGGAGGCTTTTTTTCTGTCATGATGTATAGCAGTATGCTTGCCTACATTGTGGATGCTAAT
GTCGGAAGGTCTTCCGGGGCTGTCGCCGCGAGTACTTTCTTTCGTGGAATACTCGCATTCACCAGCCTTGAGACC
GCAGTTCCGATGCAGGAACATTTGGGTGATGGTTGGATGTACACCATCTGGGGCTTTATTGTTTCTCTTTCTGGC
ATTCTTTGCATCTGGACGACTTACAAAGGAGCTGAATGGAGGCAAAGAGCAGAAGATCGTGAAAACAAACAAGCT
AATTAA
Gene >AgabiH97|098080
ATGGACCAAATCGAATCACTCCCCAAAAACGATGCAGAAAGACAGGGGGTCCAGAGCGAGGTAGATATTGAACAC
GCTCCAGTGGCTAACGATCCGCGCAAGTGGTCGGCTGTGAAGAAGGTCAGCCTCTCGCAAATTCCGTCTCACCGA
GAAACTAGCCGAATGTGACATATATGTTTCAGACAACAGTGTTGCTTTTGATTTCTTCAGCGTCAATGAGTGTTG
GAATAGTGGCTGCTATTCAGAATCGTACGTATCTGTGAACTGCTCCCCGTTTCTGTGGATTCGAGTCAGGTATGT
CCTGGCAGCCGCGGTCAAAGCAATGGAGCAGGATCTTCCTGCAACTAGCGACCAATTCAGTTTGAGTCTCTCGCT
CTTTGTGCTTGTGCAAGGTTTCATGCCGATTGCGTGGACCTCTCTCGGTGAGATCAAGGGTAGAAAAGTGCGCCT
CTACTTCACTCAGCCCTGATCTTCGCAATTTACTATAAACTCGATCAGATTGTCTATTTACTGGCTCTAGCCCTC
TCTACCGTCGCCGCTATCGCTATTGCTCTAAGCCCATCCATCGGCCTGTGAGTCCTCGCTTTTTCGCCGTTTATA
TTTGAGAGTCTTAATCTACTGGAAAAAGTGTGATAGGATTCAGATGCGTCCAGGCAATGGGGTGCGTCTCGTGGT
CATCATGTCTCTAGTATAAACCGGAAGGGTTTACGGCCCATGAAAAGGTCATGCGCTTTCCTTGCAGTTGGGGCC
GCAACTCTTGCTGATATATACGAACCTCACAAACGCGGAACTAAGGTAAGGCTACACGATTCCATTTATCTCGAT
GACGGGATTTCATTGCCAGTTTAGATGGGGCTATATTACACGGCGCCACTGCTTGGGCCAGTAAGTCGTATACTG
TACATGAAATGACAACCCGATTTATACTGGCTTAAAGTCACTTGGCCCTATTCTTGGAGGTGGATTGACTTCCGG
ATTTGGGTGGAGATCGATTTTCTGGTTTTGTGCTATCATCGGCGGCATTTGTTTCGCTGCGTTTCTTCTCCTCTT
CAACGACACCTTCAGGAAGGAAAGGAGCTTGACATACCAGGCAATCGTGAAACAGCGGCAACAGAAACAGACATC
CGAGAACTTTGAACTCCAGTCAAAGTCGGGCCATGATTTTGCCGATGCTAACGGTGATATATCACCAACGCCGGA
AATCAAGATCACTTTTCGAGACGTCAATCCACTCAAACCGATTTATCTTATCCTTCGTCGGTGGAACAATTTGGC
AATGCTTTTTGCAACTGGTGAGGTCCCATTTACAGTTTCTCTCTCATCTACTTCACCGAGAGTCGTCTCAGGTAT
TGTCCTCGCGTGGCAGCTGACCATTGTCTACACGATCGCGCGGACATTGACATCAAGGTATAATTACGATGCTTG
GAAGGTTGGTTTCACATCACTTGCTTATGGAGTTGGTGAGCGCTCTGGAATATCTCTTAACCTTGGTAACTTGGT
GTGATAATTTGGGAATCACTATCCAGGGGCTCTTTTCGGGAGTGTAATTGGAGGTAGATTGTCCGACCGCATGTT
GCGTAGGACGATGGCGGAGAATGGCGGTCTAATTCATCCTGAAGTATGTCTCACTGTTACCGTCCTTGTAATCCA
TGTTCTAACATTTGGTCGATAAGGTACGGTTGAAAAGCACGATGCTGAGTATGTTCTTCTTCCCTGCCTTTGTCA
TAGCAGGTGGTTGGGTAACCCAAGCCCATGCTCACATTGTTGCTGTCATCGTGATACTCTTCGGTGGAGGCTTTT
TTTCTGTGCACGTTCTTTTTTCCTCTTCAACGATAACGGTAAGCTAATACGCTATTTTAGCATGATGTATAGCAG
TATGCTTGCCTACATTGTGGATGCTAATGTCGGAAGGTCTTCCGGGGCTGTCGCCGCGAGTACTTTCTTTCGTGG
AATACTCGCATTCACCAGCCTTGAGACCGCAGTTCCGATGCAGGTATGTCATCGAAGTTCTATCCTGAATGTTAC
TGCTTACATGAGTTTGATAAAAAGGAACATTTGGGTGATGGTAAGTCGCACTCCAATAATCTAGATGTGACAATT
GACGCAGTCTTCTAGGTTGGATGTACACCATCTGGGGCTTTATTGTTTCTCTTTCTGGCATTCTTTGCATCTGGA
CGACTTACAAAGGAGCTGAATGGAGGCAAAGAGCAGAAGATCGTGAAAACAAACAAGCTAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail