Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|098070
Gene name
Locationscaffold_7:246102..246906
Strand+
Gene length (bp)804
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 1.0E-09 74 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 44 197 4.0E-12
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 25 196 1.0E-11
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 80 197 4.0E-09
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 90 197 4.0E-09
sp|Q9SXZ2|FT_ARATH Protein FLOWERING LOCUS T OS=Arabidopsis thaliana GN=FT PE=1 SV=2 21 196 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 44 197 4.0E-12
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 25 196 1.0E-11
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 80 197 4.0E-09
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 90 197 4.0E-09
sp|Q9SXZ2|FT_ARATH Protein FLOWERING LOCUS T OS=Arabidopsis thaliana GN=FT PE=1 SV=2 21 196 7.0E-09
sp|P31044|PEBP1_RAT Phosphatidylethanolamine-binding protein 1 OS=Rattus norvegicus GN=Pebp1 PE=1 SV=3 90 195 1.0E-08
sp|P70296|PEBP1_MOUSE Phosphatidylethanolamine-binding protein 1 OS=Mus musculus GN=Pebp1 PE=1 SV=3 90 195 2.0E-08
sp|Q8VIN1|PEBP2_MOUSE Phosphatidylethanolamine-binding protein 2 OS=Mus musculus GN=Pbp2 PE=1 SV=1 39 195 2.0E-08
sp|Q8MK67|PEBP1_RABIT Phosphatidylethanolamine-binding protein 1 OS=Oryctolagus cuniculus GN=PEBP1 PE=2 SV=1 90 195 4.0E-08
sp|Q9XFK7|MFT_ARATH Protein MOTHER of FT and TF 1 OS=Arabidopsis thaliana GN=MFT PE=1 SV=1 42 196 7.0E-08
sp|Q9FIT4|BFT_ARATH Protein BROTHER of FT and TFL 1 OS=Arabidopsis thaliana GN=BFT PE=3 SV=1 37 196 8.0E-08
sp|Q06252|YL179_YEAST Uncharacterized protein YLR179C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR179C PE=1 SV=1 42 202 1.0E-07
sp|Q9D9G2|PEBP4_MOUSE Phosphatidylethanolamine-binding protein 4 OS=Mus musculus GN=Pebp4 PE=1 SV=1 90 197 1.0E-07
sp|Q5UR88|PEBPH_MIMIV Phosphatidylethanolamine-binding protein homolog R644 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R644 PE=1 SV=1 90 197 1.0E-07
sp|Q9S7R5|TSF_ARATH Protein TWIN SISTER of FT OS=Arabidopsis thaliana GN=TSF PE=2 SV=1 65 197 3.0E-07
sp|P54190|TES26_TOXCA 26 kDa secreted antigen OS=Toxocara canis GN=TES-26 PE=2 SV=1 38 196 4.0E-07
sp|P93003|TFL1_ARATH Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1 42 197 6.0E-07
sp|P30086|PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens GN=PEBP1 PE=1 SV=3 90 195 8.0E-07
sp|Q5R4R0|PEBP1_PONAB Phosphatidylethanolamine-binding protein 1 OS=Pongo abelii GN=PEBP1 PE=2 SV=3 76 195 8.0E-07
sp|Q93WI9|HD3A_ORYSJ Protein HEADING DATE 3A OS=Oryza sativa subsp. japonica GN=HD3A PE=1 SV=1 61 196 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|098070
MRLSLTLLSLFTLLVGAQDTSIRDVRRAFADANIPEDLSINFEPTALLQVTFPQGDSDPITLHAGVQLRRDSTAG
PPTYAVSGTSCPGPFVIASVDPDAPTPQTPTSSQIRHFLGGNFSPRGSARMLSNSTAAVSEFRQPTPPAGSDAHR
YIFLLFEQPEGFNDQTVVTPETPISLFNISAFAARVGLGDPIAGTFMLVAPNPTA*
Coding >AgabiH97|098070
ATGCGCCTATCCCTCACTTTGCTATCGCTCTTCACTTTGCTGGTTGGTGCTCAGGATACCAGCATCAGGGATGTT
AGGAGAGCTTTCGCCGACGCCAATATTCCCGAGGACCTCTCAATCAATTTTGAACCCACTGCCCTGCTTCAAGTA
ACTTTCCCCCAGGGCGATAGTGATCCCATAACACTTCATGCGGGCGTACAACTTCGTCGCGATTCCACCGCCGGT
CCCCCTACTTATGCGGTTTCTGGCACATCTTGTCCCGGTCCTTTTGTCATTGCTTCAGTTGACCCCGATGCGCCG
ACTCCTCAAACGCCTACATCTTCTCAAATTCGTCATTTCCTGGGAGGGAATTTCTCCCCTCGAGGATCTGCTAGA
ATGTTGAGCAATTCAACGGCAGCTGTTAGTGAATTCAGGCAGCCCACACCTCCAGCCGGTTCTGATGCTCACAGG
TATATCTTCTTGTTGTTCGAACAACCTGAGGGGTTCAATGACCAAACCGTCGTGACGCCTGAAACACCAATCAGC
TTGTTCAACATTAGCGCTTTTGCCGCTAGAGTCGGACTGGGAGATCCTATTGCGGGGACTTTTATGTTGGTCGCG
CCGAATCCAACAGCCTGA
Transcript >AgabiH97|098070
ATGCGCCTATCCCTCACTTTGCTATCGCTCTTCACTTTGCTGGTTGGTGCTCAGGATACCAGCATCAGGGATGTT
AGGAGAGCTTTCGCCGACGCCAATATTCCCGAGGACCTCTCAATCAATTTTGAACCCACTGCCCTGCTTCAAGTA
ACTTTCCCCCAGGGCGATAGTGATCCCATAACACTTCATGCGGGCGTACAACTTCGTCGCGATTCCACCGCCGGT
CCCCCTACTTATGCGGTTTCTGGCACATCTTGTCCCGGTCCTTTTGTCATTGCTTCAGTTGACCCCGATGCGCCG
ACTCCTCAAACGCCTACATCTTCTCAAATTCGTCATTTCCTGGGAGGGAATTTCTCCCCTCGAGGATCTGCTAGA
ATGTTGAGCAATTCAACGGCAGCTGTTAGTGAATTCAGGCAGCCCACACCTCCAGCCGGTTCTGATGCTCACAGG
TATATCTTCTTGTTGTTCGAACAACCTGAGGGGTTCAATGACCAAACCGTCGTGACGCCTGAAACACCAATCAGC
TTGTTCAACATTAGCGCTTTTGCCGCTAGAGTCGGACTGGGAGATCCTATTGCGGGGACTTTTATGTTGGTCGCG
CCGAATCCAACAGCCTGA
Gene >AgabiH97|098070
ATGCGCCTATCCCTCACTTTGCTATCGCTCTTCACTTTGCTGGTTGGTGCTCAGGATACCAGCATCAGGGATGTT
AGGAGAGCTTTCGCCGACGCCAATGTAAGTATCTCAGTAACGTTCCGGCTTCTTAAAAGTATGGCTTACGTTCGT
TCTGGTTATCAGATTCCCGAGGACCTCTCAATCAATTTTGAACCCACTGCCCTGCTTCAAGTAACTTTCCCCCAG
GGCGATAGTGATCCCATAACACTTCATGCGGGCGTACAACTTCGTCGCGATTGTATGTTAAACTCCCCTTAAGAT
TAATCCATCTCTTGACTGGATTCCCTTCATGATCAGCCACCGCCGGTCCCCCTACTTATGCGGTTTCTGGCACAT
CTTGTCCCGGTCCTTTTGTCATTGCTTCAGTTGACCCCGATGCGCCGACTCCTCAAACGCCTACATCTTCTCAAA
TTCGTCATTTCCTGGGAGGGAATTTCTCCCCTCGAGGATCTGCTAGAATGTTGAGCAATTCAACGGCAGCTGTTA
GTGAATTCAGGCAGCCCACACCTCCAGCCGGTTCTGATGCTCACAGGTCCGCTTTCTATTGTCTTATTACGAATC
AATACTGATGCATATGTTATATACTATACACATAGGTATATCTTCTTGTTGTTCGAACAACCTGAGGGGTTCAAT
GACCAAACCGTCGTGACGCCTGAAACACCAATCAGCTTGTTCAACATTAGCGCTTTTGCCGCTAGAGTCGGACTG
GGAGATCCTATTGCGGGGACTTTTATGTTGGTCGCGCCGAATCCAACAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail