Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097830
Gene name
Locationscaffold_7:167931..169839
Strand-
Gene length (bp)1908
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 6.2E-133 11 527

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8BXQ2|PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus GN=Pigt PE=1 SV=2 15 530 5.0E-77
sp|Q969N2|PIGT_HUMAN GPI transamidase component PIG-T OS=Homo sapiens GN=PIGT PE=1 SV=1 25 530 2.0E-76
sp|O94380|GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi16 PE=3 SV=1 22 526 6.0E-70
sp|P38875|GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI16 PE=1 SV=2 25 528 2.0E-57

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0043412 macromolecule modification No
GO:1905368 peptidase complex No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0098796 membrane protein complex No
GO:0008303 caspase complex No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:1905369 endopeptidase complex No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 496 518 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097830
MRLALRWFFLFLVGCSSVYGHEEYFNENLKISSLQDGRVSTTFSFETILKGVPPRDPRLLNAPDSSQHYIVFPLA
LGQILREYAVTELHLTLNAGSWNYERWGYPEESGVGTGAELWAWMGAGAPMSIDDRWQGLRNALAGLFCASLGTL
DEQRTTSPTHSYFPHGILPSWNGSSAHELRHGSMPSEHVCTENLTPFLKLLPCKSLSGIASLLNPHRIFDADWHG
LGIHVLWSGEGGIKVRLSFQGVMDPLRPSISQKRDWSLESLFGRSIERSCPAANSSNIYVTLPSEAYNISPEPSK
VVGQLASYDILGDKSFNVAMKWPRSFQYSPSYETSVPISVVRTLRGATQASGKLSLVISNHRSTPQSLVYLETMP
WLVQFQLHTLQARVDGRIRDDVISNISYMAPVPHSRPATFQAELRLAPRSVTHLTMDVDKAFLRYTEHPPDAQRG
WDLPPAVLIPILSDTEDNHTHSSNRQRLGQPIYTSTLLVDVATPDFSMPYNVIIFTCSLIAFIFGSVFNLLTRKF
VVIGPDQPPQK*
Coding >AgabiH97|097830
ATGAGACTGGCCTTGCGCTGGTTTTTTCTGTTCCTCGTCGGCTGTAGTAGTGTCTATGGACACGAAGAATATTTC
AATGAAAATTTGAAGATTTCCTCTCTACAAGACGGCCGCGTGTCTACCACTTTCTCGTTCGAAACTATCCTGAAG
GGAGTACCGCCCAGGGATCCTCGTCTATTAAATGCTCCCGACTCATCTCAACACTATATCGTATTCCCTCTGGCT
CTTGGACAAATCCTCAGAGAATATGCGGTGACGGAGTTGCACCTCACACTCAATGCTGGGAGTTGGAATTACGAA
CGTTGGGGATATCCTGAAGAAAGCGGGGTAGGAACTGGAGCAGAATTATGGGCTTGGATGGGTGCTGGAGCACCG
ATGAGCATAGATGATCGATGGCAAGGTCTGCGTAACGCCCTGGCAGGTCTATTCTGCGCTTCCTTGGGTACTCTT
GATGAGCAGCGGACGACCTCTCCAACCCATTCGTATTTCCCTCATGGTATTCTTCCCAGCTGGAATGGGAGCTCT
GCTCATGAACTACGACATGGTTCTATGCCTTCTGAACACGTTTGCACGGAGAACTTGACGCCGTTTCTCAAACTA
CTGCCCTGCAAATCCCTATCCGGGATAGCAAGTCTTTTGAACCCCCACCGAATATTTGACGCGGACTGGCATGGG
TTAGGCATCCATGTCCTTTGGTCGGGAGAAGGTGGCATAAAAGTTCGTTTATCATTCCAGGGTGTGATGGACCCT
CTTCGACCCTCCATTAGTCAAAAAAGGGACTGGTCTCTTGAGTCATTATTTGGCCGTTCCATCGAAAGAAGTTGT
CCAGCCGCAAATTCCAGCAATATTTACGTGACTTTACCGTCTGAAGCTTATAACATTTCCCCGGAACCTTCCAAA
GTCGTCGGGCAACTGGCCTCTTACGACATACTCGGAGATAAGTCTTTCAACGTTGCCATGAAATGGCCCCGGAGT
TTTCAGTATTCCCCCTCCTACGAGACGTCGGTTCCTATCTCCGTTGTTCGGACCCTCAGAGGTGCTACACAAGCC
AGCGGGAAACTATCTCTTGTCATAAGCAATCACCGATCAACACCCCAATCGTTAGTCTATCTCGAGACGATGCCG
TGGCTGGTGCAATTTCAGTTGCACACGTTGCAAGCTCGTGTTGACGGTCGTATCCGAGACGACGTAATTTCCAAT
ATTTCCTATATGGCCCCGGTACCCCACTCACGCCCAGCTACATTTCAAGCAGAACTTCGCCTGGCACCTAGAAGT
GTGACTCACCTGACCATGGACGTGGACAAGGCTTTTCTCCGCTATACAGAGCATCCACCTGATGCACAACGAGGC
TGGGATCTACCTCCCGCAGTCCTGATACCTATATTGTCTGACACTGAAGACAACCACACCCATTCGTCTAATCGA
CAGAGGTTGGGTCAACCTATCTATACGTCCACATTACTCGTCGATGTTGCCACTCCCGACTTTAGCATGCCTTAT
AACGTCATCATCTTCACATGCTCCCTCATTGCCTTCATCTTCGGCAGTGTCTTCAACCTGTTGACGAGAAAGTTT
GTTGTGATAGGTCCAGACCAACCTCCACAAAAGTGA
Transcript >AgabiH97|097830
ATGAGACTGGCCTTGCGCTGGTTTTTTCTGTTCCTCGTCGGCTGTAGTAGTGTCTATGGACACGAAGAATATTTC
AATGAAAATTTGAAGATTTCCTCTCTACAAGACGGCCGCGTGTCTACCACTTTCTCGTTCGAAACTATCCTGAAG
GGAGTACCGCCCAGGGATCCTCGTCTATTAAATGCTCCCGACTCATCTCAACACTATATCGTATTCCCTCTGGCT
CTTGGACAAATCCTCAGAGAATATGCGGTGACGGAGTTGCACCTCACACTCAATGCTGGGAGTTGGAATTACGAA
CGTTGGGGATATCCTGAAGAAAGCGGGGTAGGAACTGGAGCAGAATTATGGGCTTGGATGGGTGCTGGAGCACCG
ATGAGCATAGATGATCGATGGCAAGGTCTGCGTAACGCCCTGGCAGGTCTATTCTGCGCTTCCTTGGGTACTCTT
GATGAGCAGCGGACGACCTCTCCAACCCATTCGTATTTCCCTCATGGTATTCTTCCCAGCTGGAATGGGAGCTCT
GCTCATGAACTACGACATGGTTCTATGCCTTCTGAACACGTTTGCACGGAGAACTTGACGCCGTTTCTCAAACTA
CTGCCCTGCAAATCCCTATCCGGGATAGCAAGTCTTTTGAACCCCCACCGAATATTTGACGCGGACTGGCATGGG
TTAGGCATCCATGTCCTTTGGTCGGGAGAAGGTGGCATAAAAGTTCGTTTATCATTCCAGGGTGTGATGGACCCT
CTTCGACCCTCCATTAGTCAAAAAAGGGACTGGTCTCTTGAGTCATTATTTGGCCGTTCCATCGAAAGAAGTTGT
CCAGCCGCAAATTCCAGCAATATTTACGTGACTTTACCGTCTGAAGCTTATAACATTTCCCCGGAACCTTCCAAA
GTCGTCGGGCAACTGGCCTCTTACGACATACTCGGAGATAAGTCTTTCAACGTTGCCATGAAATGGCCCCGGAGT
TTTCAGTATTCCCCCTCCTACGAGACGTCGGTTCCTATCTCCGTTGTTCGGACCCTCAGAGGTGCTACACAAGCC
AGCGGGAAACTATCTCTTGTCATAAGCAATCACCGATCAACACCCCAATCGTTAGTCTATCTCGAGACGATGCCG
TGGCTGGTGCAATTTCAGTTGCACACGTTGCAAGCTCGTGTTGACGGTCGTATCCGAGACGACGTAATTTCCAAT
ATTTCCTATATGGCCCCGGTACCCCACTCACGCCCAGCTACATTTCAAGCAGAACTTCGCCTGGCACCTAGAAGT
GTGACTCACCTGACCATGGACGTGGACAAGGCTTTTCTCCGCTATACAGAGCATCCACCTGATGCACAACGAGGC
TGGGATCTACCTCCCGCAGTCCTGATACCTATATTGTCTGACACTGAAGACAACCACACCCATTCGTCTAATCGA
CAGAGGTTGGGTCAACCTATCTATACGTCCACATTACTCGTCGATGTTGCCACTCCCGACTTTAGCATGCCTTAT
AACGTCATCATCTTCACATGCTCCCTCATTGCCTTCATCTTCGGCAGTGTCTTCAACCTGTTGACGAGAAAGTTT
GTTGTGATAGGTCCAGACCAACCTCCACAAAAGTGA
Gene >AgabiH97|097830
ATGAGACTGGCCTTGCGCTGGTTTTTTCTGTTCCTCGTCGGCTGTAGTAGTGTCTATGGACACGAAGAATATTTC
AATGAAAATTTGAAGATTTCCTCTCTACAAGACGGCCGCGTGTCTACCACTTTCTCGTTCGAAACTATCCTGAAG
GGAGTACCGCCCAGGGATCCTCGTCTATTAAATGCTCCCGACTCATGTATGTCCTCAATTTATCGTGCTGGACAA
AGGGGCCTGACATTAAACAGCTCAACACTATATCGTATTCCCTCTGGCTCTTGGACAAATCCTCAGAGAATATGC
GGTGACGGAGTTGCACCTCACACTCAATGCTGGGAGTTGGAATTACGAACGTTGGGGATATCCTGAAGAAAGCGG
GGTAGGAACTGGAGCAGAATTATGGGCTTGGATGGGTGCTGGAGCACCGATGAGGTCGGTGTACCCGTACTGTAA
GAAAACCTTCTGACCCATAACAGCATAGATGATCGATGGCAAGGTCTGCGTAACGCCCTGGCAGGTCTATTCTGC
GCTTCCTTGGGTACTCTTGATGAGCAGCGGACGACCTCTCCAACCCATTCGTATTTCCCTCATGGTATTCTTCCC
AGCTGGAATGGGAGCTCTGCTCATGAACTACGACATGGTTCTATGCCTTCTGAACACGTTTGCACGGAGAACTTG
ACGCCGTTTCTCAAACTACTGCCCTGCAAATCCCTATCCGGGATAGCAAGTCTTTTGAACCCCCACCGAATATTT
GACGCGGACTGGCATGGGTTAGGCATCCATGTCCTTTGGTCGGGAGAAGGTGGCATAAAAGTTCGTTTATCATTC
CAGGGTGTGATGGACCCTCTTCGACCCTCCATTAGTCAAAAAAGGGGTAGGTTTCTCAACGGACGTCATGGATTC
GGTACTTATGGGAGTTAGACTGGTCTCTTGAGTCATTATTTGGCCGTTCCATCGAAAGAAGTTGTCCAGCCGCAA
ATTCCAGCAATATTTACGTGACTTTACCGTCTGAAGCTTATAACATTTCCCCGGAACCTTCCAAAGTCGTCGGGC
AACTGGCCTCTTACGACATACTCGGAGGTAAGTATCTCTTAGCGAACGAAACAATTGCCGAAATTTGTCTAACGA
TGTGATTAGTAGATAAGTCTTTCAACGTTGCCATGAAATGGCCCCGGAGTTTTCAGTATTGTATGTGACCATCTA
TCTATATTTTTAGCCGAAAAATGATAGTTCCATAGCCCCCTCCTACGAGACGTCGGTTCCTATCTCCGTTGTTCG
GACCCTCAGAGGTGCTACACAAGCCAGCGGGAAACTATCTCTTGTCATAAGCAATCACCGATCAACACCCCAATC
GTTAGTCTATCTCGAGACGATGCCGTGGCTGGTGCAATTTCAGTTGCACACGTTGCAAGCTCGTGTTGACGGTCG
TATCCGAGGTGAGCAAATCAGCTGGCCCTGCTCAATATCCCTAATCAAGTTTTAGACGACGTAATTTCCAATATT
TCCTATATGGCCCCGGTACCCCACTCACGCCCAGCTACATTTCAAGCAGAACTTCGCCTGGCACCTAGAAGTGTG
ACTCACCTGACCATGGACGTGGACAAGGCTTTTCTCCGCTATACAGAGCATCCACCTGATGCACAACGAGGCTGG
GATCTACCTCCCGCAGTCCTGATACCTATATTGTCTGACACTGAAGACAACCACACCCATTCGTCTAATCGACAG
AGGTTGGGTCAACCTATCTATACGTCCACATTACTCGTCGATGTTGCCACTCCCGACTTTAGCATGCCTTATAAC
GTCATCATCTTCACATGCTCCCTCATTGCCTTCATCTTCGGCAGTGTCTTCAACCTGTTGACGAGAAAGTTTGTT
GTGATAGGTCCAGACCAACCTCCACAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail