Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097530
Gene name
Locationscaffold_7:81075..83282
Strand-
Gene length (bp)2207
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.8E-25 102 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76628|YGAY_ECOLI Putative uncharacterized transporter YgaY OS=Escherichia coli (strain K12) GN=ygaY PE=5 SV=2 102 447 2.0E-39
sp|Q8X4V6|YGAY_ECO57 Uncharacterized transporter YgaY OS=Escherichia coli O157:H7 GN=ygaY PE=3 SV=1 102 447 3.0E-39
sp|P96675|YDER_BACSU Uncharacterized MFS-type transporter YdeR OS=Bacillus subtilis (strain 168) GN=ydeR PE=3 SV=1 104 467 8.0E-39
sp|Q9ADP8|Y4007_STRCO Probable transporter SCO4007 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4007 PE=2 SV=1 100 354 7.0E-33
sp|P43531|YNFM_ECOLI Inner membrane transport protein YnfM OS=Escherichia coli (strain K12) GN=ynfM PE=1 SV=2 103 474 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76628|YGAY_ECOLI Putative uncharacterized transporter YgaY OS=Escherichia coli (strain K12) GN=ygaY PE=5 SV=2 102 447 2.0E-39
sp|Q8X4V6|YGAY_ECO57 Uncharacterized transporter YgaY OS=Escherichia coli O157:H7 GN=ygaY PE=3 SV=1 102 447 3.0E-39
sp|P96675|YDER_BACSU Uncharacterized MFS-type transporter YdeR OS=Bacillus subtilis (strain 168) GN=ydeR PE=3 SV=1 104 467 8.0E-39
sp|Q9ADP8|Y4007_STRCO Probable transporter SCO4007 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4007 PE=2 SV=1 100 354 7.0E-33
sp|P43531|YNFM_ECOLI Inner membrane transport protein YnfM OS=Escherichia coli (strain K12) GN=ynfM PE=1 SV=2 103 474 9.0E-08
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 112 274 5.0E-07
sp|Q8K902|Y567_BUCAP Uncharacterized transporter BUsg_567 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_567 PE=3 SV=1 90 356 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 128 150 22
3 157 176 19
4 181 203 22
5 216 238 22
6 243 265 22
7 293 315 22
8 330 352 22
9 359 393 34
10 445 467 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097530
MTNSSSLSEDSVRTKQHDPDLEKEAQEFKDDSDDVSPKSPSTIANDSPKSQEESLGHRSSETKLRTRDFGIFPIP
EHLQHRLDRPFHFGLTLNIAFGVFSTFTVANLYYCQPLLVQIADSFGVTHAKVSNIPTLIQAGYAGGLLFITPLG
DLVRRRSLILLTIILSLVFSIGLAVTQSVEAFEALSFIVGAVSVTPQILMPLVADLAPDNRRASAIAIVFSGLLF
GILVARVLAGIIAEFVIWRVVYYFAIGVQALVLLGSYLLLPDYPSRNKNMTYWGILSTMAKFAVTEPVLIQSCII
NLCSSACFASFWVTLTFLLDGPPYHYSTLVIGLFGLIGMAGVSLGPIGGRIIDKWQPWFISLFNICMLLVFQAIQ
TAAGGINVAAVIIVTFGIDVFRQNLQVSLSTSIFMIDPAARSRLNAVSILSIFIGQVMGTSVGTRVFIKFGWRAC
AALSLGWTGFMFLVLLLRGPHCPRYTWFGYEGGISVRKTISSSVPPNQDNTPQKQEQPQPIDRSLLLGSVGSYGL
*
Coding >AgabiH97|097530
ATGACGAACAGCAGTTCTCTTTCAGAGGACAGTGTTCGCACTAAACAACATGATCCGGATCTAGAGAAAGAGGCT
CAGGAGTTCAAGGACGACTCTGACGACGTCTCCCCAAAATCACCCTCTACTATAGCCAATGATTCGCCAAAATCA
CAGGAAGAGTCACTTGGCCACCGTTCCTCCGAAACCAAACTGCGTACTCGAGATTTCGGCATCTTTCCGATTCCG
GAACATCTACAACACCGTCTTGACAGGCCTTTCCATTTTGGTTTGACATTGAATATCGCTTTTGGAGTATTCAGT
ACTTTCACCGTCGCCAATTTGTATTATTGTCAGCCTCTTCTGGTTCAGATTGCCGACAGTTTTGGAGTGACACAT
GCTAAAGTGTCAAATATCCCTACGCTTATCCAGGCAGGATACGCTGGAGGACTCTTGTTCATCACGCCCCTAGGT
GATTTGGTTCGGCGAAGATCACTCATCCTCCTCACCATAATCCTCTCACTGGTATTCTCAATCGGTTTGGCCGTG
ACCCAAAGCGTTGAAGCCTTCGAAGCTCTATCTTTCATCGTAGGAGCCGTATCCGTTACACCACAAATCCTCATG
CCGCTAGTCGCTGACCTCGCTCCAGACAATCGCAGAGCGTCAGCCATTGCAATCGTTTTTTCCGGTTTACTCTTT
GGGATCCTCGTCGCCCGTGTCCTAGCCGGAATCATCGCAGAATTTGTCATATGGCGTGTAGTTTATTACTTTGCT
ATTGGAGTCCAAGCTCTAGTTTTGCTCGGATCTTATCTTTTGCTGCCGGATTACCCGTCAAGGAACAAAAATATG
ACTTATTGGGGTATTTTATCCACTATGGCCAAGTTTGCAGTCACGGAACCTGTGTTGATTCAAAGTTGCATCATC
AATTTATGCTCAAGCGCCTGTTTCGCGAGCTTTTGGGTAACCTTGACCTTCTTATTAGATGGTCCACCCTATCAT
TATTCCACACTCGTAATTGGACTCTTCGGGTTGATCGGGATGGCTGGTGTATCATTGGGACCCATCGGCGGACGT
ATCATCGATAAATGGCAACCTTGGTTCATATCTCTCTTTAATATCTGCATGCTCCTCGTTTTTCAAGCAATTCAA
ACTGCGGCTGGTGGTATAAACGTTGCGGCTGTCATCATTGTGACTTTTGGAATCGATGTGTTCCGTCAAAATCTT
CAAGTATCGCTCTCAACTTCTATCTTCATGATTGATCCTGCCGCACGTTCAAGATTGAATGCCGTCAGTATCCTA
TCAATATTCATCGGACAGGTGATGGGAACATCCGTCGGCACTCGTGTTTTTATCAAATTCGGTTGGAGAGCCTGT
GCAGCCCTAAGTTTAGGATGGACAGGATTCATGTTCCTCGTGCTCTTATTACGAGGACCGCATTGTCCGAGGTAC
ACGTGGTTCGGATATGAGGGTGGAATCAGCGTTAGGAAAACAATTTCCTCTTCCGTACCGCCGAATCAAGATAAC
ACGCCACAAAAGCAAGAGCAACCGCAGCCGATAGATAGATCATTGTTGCTTGGGTCTGTGGGTTCATATGGTTTA
TGA
Transcript >AgabiH97|097530
ATGACGAACAGCAGTTCTCTTTCAGAGGACAGTGTTCGCACTAAACAACATGATCCGGATCTAGAGAAAGAGGCT
CAGGAGTTCAAGGACGACTCTGACGACGTCTCCCCAAAATCACCCTCTACTATAGCCAATGATTCGCCAAAATCA
CAGGAAGAGTCACTTGGCCACCGTTCCTCCGAAACCAAACTGCGTACTCGAGATTTCGGCATCTTTCCGATTCCG
GAACATCTACAACACCGTCTTGACAGGCCTTTCCATTTTGGTTTGACATTGAATATCGCTTTTGGAGTATTCAGT
ACTTTCACCGTCGCCAATTTGTATTATTGTCAGCCTCTTCTGGTTCAGATTGCCGACAGTTTTGGAGTGACACAT
GCTAAAGTGTCAAATATCCCTACGCTTATCCAGGCAGGATACGCTGGAGGACTCTTGTTCATCACGCCCCTAGGT
GATTTGGTTCGGCGAAGATCACTCATCCTCCTCACCATAATCCTCTCACTGGTATTCTCAATCGGTTTGGCCGTG
ACCCAAAGCGTTGAAGCCTTCGAAGCTCTATCTTTCATCGTAGGAGCCGTATCCGTTACACCACAAATCCTCATG
CCGCTAGTCGCTGACCTCGCTCCAGACAATCGCAGAGCGTCAGCCATTGCAATCGTTTTTTCCGGTTTACTCTTT
GGGATCCTCGTCGCCCGTGTCCTAGCCGGAATCATCGCAGAATTTGTCATATGGCGTGTAGTTTATTACTTTGCT
ATTGGAGTCCAAGCTCTAGTTTTGCTCGGATCTTATCTTTTGCTGCCGGATTACCCGTCAAGGAACAAAAATATG
ACTTATTGGGGTATTTTATCCACTATGGCCAAGTTTGCAGTCACGGAACCTGTGTTGATTCAAAGTTGCATCATC
AATTTATGCTCAAGCGCCTGTTTCGCGAGCTTTTGGGTAACCTTGACCTTCTTATTAGATGGTCCACCCTATCAT
TATTCCACACTCGTAATTGGACTCTTCGGGTTGATCGGGATGGCTGGTGTATCATTGGGACCCATCGGCGGACGT
ATCATCGATAAATGGCAACCTTGGTTCATATCTCTCTTTAATATCTGCATGCTCCTCGTTTTTCAAGCAATTCAA
ACTGCGGCTGGTGGTATAAACGTTGCGGCTGTCATCATTGTGACTTTTGGAATCGATGTGTTCCGTCAAAATCTT
CAAGTATCGCTCTCAACTTCTATCTTCATGATTGATCCTGCCGCACGTTCAAGATTGAATGCCGTCAGTATCCTA
TCAATATTCATCGGACAGGTGATGGGAACATCCGTCGGCACTCGTGTTTTTATCAAATTCGGTTGGAGAGCCTGT
GCAGCCCTAAGTTTAGGATGGACAGGATTCATGTTCCTCGTGCTCTTATTACGAGGACCGCATTGTCCGAGGTAC
ACGTGGTTCGGATATGAGGGTGGAATCAGCGTTAGGAAAACAATTTCCTCTTCCGTACCGCCGAATCAAGATAAC
ACGCCACAAAAGCAAGAGCAACCGCAGCCGATAGATAGATCATTGTTGCTTGGGTCTGTGGGTTCATATGGTTTA
TGA
Gene >AgabiH97|097530
ATGACGAACAGCAGTTCTCTTTCAGAGGACAGTGTTCGCACTAAACAACATGATCCGGATCTAGAGAAAGAGGCT
CAGGAGTTCAAGGACGACTCTGACGACGTCTCCCCAAAATCACCCTCTACTATAGCCAATGATTCGCCAAAATCA
CAGGAAGAGTCACTTGGCCACCGTTCCTCCGAAACCAAACTGCGTACTCGAGATTTCGGCATCTTTCCGATTCCG
GAACATCTACAACACCGTCTTGACAGGCCTTTCCATTTTGGTTTGACATTGAATATCGCTTTTGGAGTATTCAGT
ACTTTCAGTATGTGCTTTGTTTTCCTACGGTTGCTTATCATTAATGAGGTCACTCATTTAGCCGTCGCCAATTTG
TATTATTGTCAGCCTCTTCTGGGTAAGAGATTCAAATCTTCCAACAATCCGTGAAACTCCCAGCGCTTCTTACAC
CCCTTGCAACAACAGTTCAGATTGCCGACAGTTTTGGAGTGACACATGCTAAAGTGTCAAAGTGCGTTTTCGCGA
CTTTGCTTGCGAAAAACCAAAGGATGTGCTGAGACGACCCTATAGTATCCCTACGCTTATCCAGGCAGGGTAAGT
GCAAACTTCATACTTCCAACCACAATACACCAAAACCATTCCACAGATACGCTGGAGGACTCTTGTTCATCACGC
CCCTAGGTGATTTGGTTCGGCGAAGATCACTCATCCTCCTCACCATAATCCTCTCACTGGTATTCTCAATCGGTT
TGGCCGTGACCCAAAGCGTTGAAGCCTTCGAAGCTCTATCTTTCATCGTAGGAGCCGTATCCGTTACACCACAAA
TCCTCATGCCGCTAGTCGCTGACCTCGCTCCAGACAATCGCAGAGCGTCAGCCATTGCAATCGTTTTTTCCGGTT
TACTCTTTGGGATCCTCGTCGCCCGTGTCCTAGCCGGAATCATCGCAGAATTTGTCATATGGCGTGTAGTTTATT
ACTTTGCTATTGGAGTCCAAGCTCTAGTTTTGCTCGGATCTTATCTTTTGCTGCCGGATTACCCGTCAAGGAACA
AAAATATGACTTATTGGGGTATTTTATCCACTATGGCCAAGTTTGCAGTCACGGAACCTGTGTTGATTCAAAGTT
GCATCATCAATTTATGCTCAAGCGCCTGTTTCGCGAGCTTTTGGGTAACCTTGACCTTCTTATTAGATGGTCCAC
CCTATCATTATTCCACGTGCGTTCTCAAAATATTCAATTTTCTCCCAATTCATCATAACAATAACAATTCACTCA
TATGACGTCTTGAATCAGACTCGTAATTGGACTCTTCGGGTTGATCGGGATGGCTGGTGTATCATTGGGACCCAT
CGGCGGACGTATCATCGATAAATGGCAACCTTGGTTCATATCTCTCTTTAATATCTGCATGCTCCTCGTTTTTCA
AGCAATTCAAACTGCGGCTGGTGGTATAAACGTTGCGGCTGTCATCATTGTGACTTTTGGAATCGATGTGTTCCG
TCAAAATCTTCAAGTATCGCTCTCAACTTCTATCTTCATGTAAGTCCATTTGTCCTCCTTTTACTGTATTGGATT
TCATGAATTTTTTATGTGATTAGGATTGATCCTGCCGCACGTTCAAGATTGAATGCCGTCAGTATCCTATCAGTA
CGTGCTCTTCCCTAATCCGTTTTCTTTTTTGTTTGAAGTATATATTATATATTGTTTCTAGATATTCATCGGACA
GGTGATGGGAACATCCGTCGGCACTCGTGTTTTTATCAAATTCGGTTGGAGAGCCTGTGCAGCCCTAAGTTTAGG
ATGGACAGGATTCATGTTCCTCGTGCTCTTATTACGAGGACCGCATTGTCCGAGGTACACGTGGTTCGGATATGA
GGGTGGAATCAGCGTTAGGAAAACAATTTCCTCTTCCGTACCGCCGAATCAAGATAACACGCCACAAAAGCAAGA
GCAACCGCAGGTTGTCTCGAGATAACCTATCGAGTGACTTTTAAAAGCGAGGAGGAGTTAGGTTAATAAAGGAGA
ATGGACCTTTCTAGCCATGGACTCGGATGTAGTCAGGGTGTTTGAAACTGGTGATACTTGGAAAGACGCAGCCGA
TAGATAGATCATTGTTGCTTGGGTCTGTGGGTTCATATGTACGTATTCGCTTACGTTATACGCACGATGAGAATC
TTGTAATTATTAGGTTTATGCAGGGTTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail