Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097420
Gene name
Locationscaffold_7:33869..35990
Strand-
Gene length (bp)2121
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-47 49 511
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-15 50 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 10 512 6.0E-158
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 5 512 3.0E-154
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 24 524 2.0E-152
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 1 527 1.0E-147
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 13 530 7.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 10 512 6.0E-158
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 5 512 3.0E-154
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 24 524 2.0E-152
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 1 527 1.0E-147
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 13 530 7.0E-110
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 41 512 6.0E-98
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 47 524 3.0E-87
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 47 524 6.0E-87
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 47 526 8.0E-87
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 47 512 6.0E-85
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 41 516 1.0E-84
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 47 529 6.0E-84
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 47 521 2.0E-83
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 47 512 2.0E-81
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 47 520 2.0E-81
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 47 528 9.0E-81
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 47 519 2.0E-80
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 47 512 2.0E-80
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 47 524 5.0E-80
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 47 518 6.0E-80
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 47 512 1.0E-79
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 1 519 5.0E-79
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 47 521 2.0E-76
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 47 521 1.0E-73
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 41 478 3.0E-72
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 47 524 2.0E-71
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 41 511 9.0E-71
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 41 527 8.0E-65
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 41 528 2.0E-62
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 40 501 3.0E-23
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 51 506 4.0E-23
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 1 471 6.0E-21
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 5 521 3.0E-18
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 84 512 9.0E-16
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 84 512 1.0E-15
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 41 516 7.0E-14
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 41 516 7.0E-14
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 39 516 8.0E-14
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 41 516 8.0E-14
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 39 516 3.0E-13
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 5 530 6.0E-13
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 13 512 3.0E-12
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 79 512 4.0E-12
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 82 514 1.0E-11
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 92 512 2.0E-11
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 23 512 4.0E-11
sp|P94131|MUCK_ACIAD Cis,cis-muconate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mucK PE=3 SV=1 83 511 5.0E-10
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 51 512 7.0E-10
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 47 512 1.0E-09
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 50 480 2.0E-09
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 94 497 3.0E-09
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 47 530 4.0E-09
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 47 530 4.0E-09
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 93 530 8.0E-09
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 150 512 9.0E-09
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 64 503 1.0E-08
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 24 525 1.0E-08
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 24 525 1.0E-08
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 94 519 2.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 37 501 2.0E-08
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 79 528 3.0E-08
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 94 507 3.0E-08
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 94 525 3.0E-08
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 47 455 8.0E-08
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 92 512 9.0E-08
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 37 254 1.0E-07
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 97 512 1.0E-07
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 84 512 2.0E-07
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 94 529 2.0E-07
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 93 512 2.0E-07
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 192 515 4.0E-07
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 83 467 5.0E-07
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 103 484 9.0E-07
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 46 479 2.0E-06
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 222 530 2.0E-06
sp|O30513|BENK_ACIAD Benzoate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benK PE=3 SV=2 37 466 3.0E-06
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 192 515 4.0E-06
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 93 512 4.0E-06
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 93 514 5.0E-06
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 92 512 8.0E-06
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 144 505 9.0E-06
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 94 470 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 89 106 17
3 113 132 19
4 142 164 22
5 184 206 22
6 221 238 17
7 312 334 22
8 360 382 22
9 389 406 17
10 416 438 22
11 450 472 22
12 482 504 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097420
MAKVDQDVEKTSPQESQKVHWSKLEEVEKEGRPAFMLTRTEMKLLGIAGVGFFLDAYDLFIINPVATMLQYRLYG
GEHLPTDLEGFVKAGANIGSVIGQIAFGYAADAFGRKAVYGKELMLIILGTILTMTTPTGSLSPRGSLIYLGVFR
ILLGIGVGGDYPMSATVTSDRANLRKRGTMLAYIFANQGWGSLVGALMTIIVLACYKNVMEEGQISKVDGVWRIV
VGVSLIPAFGTLYQRLTLPESTRFENTQQAQNVEQSDDQSESSKKPSSKKESETDSDLDKADDPEVPLKKKAHFR
EALAYFSEWRHLRLIMGTASCWFLLDIAFYGINLNQNVVLQQIGFDGSSGSAWNRLFKISTGNIIITALGFVPGY
YVTVLTIEKLGRKFIQIQGFLMTSLFLAILAGKFNSLSKPAFIVLFALLQFFFNFGPNSTTYCYPAEVFPTRYRA
FAHGFSAACGKCGAIISALAFNTLSKKVGTPVVLWIFFACNIAGAFCTLLLPEVRGRDPDEILAKEIEEANMKKR
IQESN*
Coding >AgabiH97|097420
ATGGCCAAGGTAGATCAAGATGTCGAGAAAACATCGCCCCAGGAGAGCCAAAAGGTTCACTGGTCGAAGCTCGAG
GAAGTCGAGAAAGAGGGTCGTCCGGCATTCATGCTCACCCGTACAGAGATGAAGTTGTTGGGAATTGCGGGTGTT
GGATTCTTCCTTGATGCCTACGATCTATTCATCATCAACCCCGTCGCCACGATGCTTCAATACCGACTTTACGGA
GGCGAACATCTACCAACCGATCTCGAAGGTTTTGTCAAGGCAGGTGCAAACATCGGTAGCGTTATCGGTCAAATT
GCCTTCGGTTATGCTGCCGATGCCTTTGGTCGTAAGGCTGTGTACGGCAAGGAGCTTATGCTCATTATTCTTGGG
ACAATATTGACCATGACGACTCCCACCGGAAGCCTCTCTCCGAGAGGGTCGCTCATTTACCTTGGCGTATTTCGT
ATTTTGCTCGGTATTGGTGTGGGAGGGGACTATCCAATGTCCGCCACCGTCACGTCTGACCGTGCCAACCTCCGC
AAACGTGGTACTATGCTCGCTTATATTTTTGCGAACCAAGGATGGGGTTCCCTTGTCGGTGCATTGATGACCATC
ATTGTCTTGGCTTGCTACAAAAACGTTATGGAGGAAGGACAAATTTCAAAAGTAGATGGAGTATGGCGTATTGTC
GTTGGCGTTTCCCTCATTCCTGCCTTCGGAACCCTGTACCAACGTCTCACGCTACCCGAATCAACGCGTTTCGAA
AACACACAACAGGCCCAGAATGTTGAGCAGTCAGATGATCAATCTGAATCATCGAAGAAACCTTCAAGCAAGAAA
GAAAGCGAGACCGACAGTGACCTGGACAAGGCTGATGACCCTGAAGTACCATTGAAAAAGAAGGCGCACTTCAGA
GAAGCCCTTGCCTACTTCAGTGAATGGCGCCACTTGCGGTTGATCATGGGAACTGCTAGCTGCTGGTTCCTACTC
GATATAGCCTTCTATGGCATCAACCTGAACCAAAACGTTGTCTTACAACAGATCGGTTTCGACGGCTCGTCTGGT
AGTGCATGGAATCGGCTTTTCAAGATCTCAACTGGTAACATTATCATCACCGCCCTCGGATTCGTACCAGGCTAC
TATGTTACCGTCCTGACGATTGAGAAACTTGGAAGGAAATTCATCCAGATCCAAGGGTTCCTTATGACCTCTCTG
TTCCTGGCTATCCTTGCGGGCAAGTTTAATTCGCTCAGCAAGCCAGCTTTCATTGTCCTTTTCGCTCTCCTACAA
TTTTTCTTCAATTTCGGTCCGAACAGCACAACCTACTGTTACCCCGCTGAAGTGTTCCCCACCCGTTACCGCGCT
TTTGCTCATGGTTTTTCCGCCGCATGCGGTAAATGTGGTGCTATCATCTCAGCACTTGCTTTCAATACCCTGAGC
AAGAAGGTCGGAACGCCTGTCGTTCTATGGATCTTCTTCGCATGTAACATTGCGGGAGCTTTCTGCACGTTGCTG
CTTCCTGAAGTTCGTGGTCGTGATCCCGATGAGATTCTTGCCAAGGAGATTGAAGAGGCTAATATGAAAAAGAGG
ATTCAAGAATCTAACTAA
Transcript >AgabiH97|097420
ATGGCCAAGGTAGATCAAGATGTCGAGAAAACATCGCCCCAGGAGAGCCAAAAGGTTCACTGGTCGAAGCTCGAG
GAAGTCGAGAAAGAGGGTCGTCCGGCATTCATGCTCACCCGTACAGAGATGAAGTTGTTGGGAATTGCGGGTGTT
GGATTCTTCCTTGATGCCTACGATCTATTCATCATCAACCCCGTCGCCACGATGCTTCAATACCGACTTTACGGA
GGCGAACATCTACCAACCGATCTCGAAGGTTTTGTCAAGGCAGGTGCAAACATCGGTAGCGTTATCGGTCAAATT
GCCTTCGGTTATGCTGCCGATGCCTTTGGTCGTAAGGCTGTGTACGGCAAGGAGCTTATGCTCATTATTCTTGGG
ACAATATTGACCATGACGACTCCCACCGGAAGCCTCTCTCCGAGAGGGTCGCTCATTTACCTTGGCGTATTTCGT
ATTTTGCTCGGTATTGGTGTGGGAGGGGACTATCCAATGTCCGCCACCGTCACGTCTGACCGTGCCAACCTCCGC
AAACGTGGTACTATGCTCGCTTATATTTTTGCGAACCAAGGATGGGGTTCCCTTGTCGGTGCATTGATGACCATC
ATTGTCTTGGCTTGCTACAAAAACGTTATGGAGGAAGGACAAATTTCAAAAGTAGATGGAGTATGGCGTATTGTC
GTTGGCGTTTCCCTCATTCCTGCCTTCGGAACCCTGTACCAACGTCTCACGCTACCCGAATCAACGCGTTTCGAA
AACACACAACAGGCCCAGAATGTTGAGCAGTCAGATGATCAATCTGAATCATCGAAGAAACCTTCAAGCAAGAAA
GAAAGCGAGACCGACAGTGACCTGGACAAGGCTGATGACCCTGAAGTACCATTGAAAAAGAAGGCGCACTTCAGA
GAAGCCCTTGCCTACTTCAGTGAATGGCGCCACTTGCGGTTGATCATGGGAACTGCTAGCTGCTGGTTCCTACTC
GATATAGCCTTCTATGGCATCAACCTGAACCAAAACGTTGTCTTACAACAGATCGGTTTCGACGGCTCGTCTGGT
AGTGCATGGAATCGGCTTTTCAAGATCTCAACTGGTAACATTATCATCACCGCCCTCGGATTCGTACCAGGCTAC
TATGTTACCGTCCTGACGATTGAGAAACTTGGAAGGAAATTCATCCAGATCCAAGGGTTCCTTATGACCTCTCTG
TTCCTGGCTATCCTTGCGGGCAAGTTTAATTCGCTCAGCAAGCCAGCTTTCATTGTCCTTTTCGCTCTCCTACAA
TTTTTCTTCAATTTCGGTCCGAACAGCACAACCTACTGTTACCCCGCTGAAGTGTTCCCCACCCGTTACCGCGCT
TTTGCTCATGGTTTTTCCGCCGCATGCGGTAAATGTGGTGCTATCATCTCAGCACTTGCTTTCAATACCCTGAGC
AAGAAGGTCGGAACGCCTGTCGTTCTATGGATCTTCTTCGCATGTAACATTGCGGGAGCTTTCTGCACGTTGCTG
CTTCCTGAAGTTCGTGGTCGTGATCCCGATGAGATTCTTGCCAAGGAGATTGAAGAGGCTAATATGAAAAAGAGG
ATTCAAGAATCTAACTAA
Gene >AgabiH97|097420
ATGGCCAAGGTAGATCAAGATGTCGAGAAAACATCGCCCCAGGAGAGCCAAAAGGTTCACTGGTCGAAGCTCGAG
GAAGTCGAGAAAGAGGGTCGTCCGGCATTCATGCTCACCCGTACAGAGATGAAGTTGTTGGGAATTGCGGGTGTA
TGTTTCTTTGATTCTCTATCTGTGATGAACCCCGGCTGACCGTTCTGCAGGTTGGATTCTTCCTTGATGGTATGT
TTTGTGGTCCGGTTATCTCTTCACTCTGCTTTTGTTGACGGCGAATCCGATCAGCCTACGATCTATTCATCATCA
ACGTACGTTCATCCATAGACTAGGTGGCCGTTCCTATACTGAATGAGAAACGTAGCCCGTCGCCACGATGCTTCA
ATACCGACTTTACGGAGGCGAACATCTACCAACCGATCTCGAAGGTTTTGTCAAGGCAGGTGCAAACATCGGTAG
CGTTATCGGTCAAATTGCCTTCGGTACGGAATTCATTCTGTCAAGGCTGTGCCTCAGTCATCTTTACTGATCGCA
ATTCGGAACAGGTTATGCTGCCGATGCCTTTGGTCGTAAGGCTGTGTGTAAGTCTCTGTGATTCCACTCTGTTTA
TCACGCGACTCAATTAATCTTTCAGACGGCAAGGAGCTTATGCTCATTATTCTTGGGACAATATTGACCATGACG
ACTCCCACCGGAAGCCTCTCTCCGAGAGGGTCGCTCATTTACCTTGGCGTATTTCGTATTTTGCTCGGTATTGGT
GTGGGAGGGGACTATCCAATGTCCGCCACCGTCACGTCTGACCGTGCCAACCTCCGCAAACGTGGTACTATGCTC
GCTTATATTTTTGCGAACCAAGGATGGGGTTCCCTTGTCGGTGCATTGATGACCATCATTGTCTTGGCTTGCTAC
AAAAACGTTATGGAGGAAGGACAAATTTCAAAAGTAGATGGAGGTAAGAGCACGCTGTTACGAACCGAACCGTCG
AATTCTGATTGTTCTCTGCATTTCATTAATGGTTAGTATGGCGTATTGTCGTTGGCGTTTCCCTCATTCCTGCCT
TCGGAACCCTGTACCAACGTCTCACGCTACCCGAATCAACGCGTTTCGAAAACACACAACAGGCCCAGAATGTTG
AGCAGTCAGATGATCAATCTGAATCATCGAAGAAACCTTCAAGCAAGAAAGAAAGCGAGACCGACAGTGACCTGG
ACAAGGCTGATGACCCTGAAGTACCATTGAAAAAGAAGGCGCACTTCAGAGAAGCCCTTGCCTACTTCAGTGAAT
GGCGCCACTTGCGGTTGATCATGGGAACTGCTAGCTGCTGGTTCCTACTCGATATAGCCTTCTATGGCATCAACC
TGAACCAAAACGTTGTCTTACAACAGATCGGTTTCGACGGCTCGTCTGGTAGTGCATGGAATCGGCTTTTCAAGA
TCTCAACTGGTAACATTATCATCACCGCCCTCGGATTCGTACCAGGCTACTATGTTACCGTCCTGACGATTGAGA
AACTTGGAAGGAAATTCATCCAGATCCAAGGGTTCCTTATGACCTCTCTGTTCCGTGAGTGTCTTAGTTATTGCC
TGCTCATGTGAAACTATTGCTGACTACATGGAATGACTTCAGTGGCTATCCTTGCGGGCAAGTTTAATTCGCTCA
GCAAGCCAGCTTTCATTGTCCTTTTCGCTCTCCTACAATTTTTCTTCAATTTCGGTCCGAACAGCACAACCTACG
TGAGGACTTTCCCTACCTTTCCAGATAATTGTCGCCTGACACCTACCCTACAGTGTTACCCCGCTGAAGTGTTCC
CCACCCGTTACCGCGCTTTTGCTCATGGTTTTTCCGCCGCATGCGGTAAATGTGGTGCTATCATCTCAGCACTTG
CTTTCAATACCCTGAGCAAGAAGGTCGGAACGCCTGTCGTTCTATGGAGTGAGTCGTACTCGTGTTATCGTGCTT
TGTTTTTTTCGCAATTACTGATATCTTCGTTTAGTCTTCTTCGCATGTAACATTGCGGGAGCTTTCTGCACGTTG
CTGCTTCCTGAAGTTCGTGGTCGTGATCCCGATGAGATTCTTGCCAAGGAGATTGAAGAGGCTAATATGAAAAAG
AGGATTCAAGAATCTAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail