Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097200
Gene name
Locationscaffold_6:2310940..2312184
Strand+
Gene length (bp)1244
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 3.2E-07 180 214

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 180 218 1.0E-07
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 180 236 3.0E-06

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003677 DNA binding No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4531 0.8415 0.0376 0.0493 0.1231 0.0006 0.0806 0.0511 0.0349 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1307
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|097200
Agaricus bisporus var bisporus H97 AgabiH97|097200 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|173_8

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097200
MATLGWQDETKETKEEAIDPALRDSSMSVNVHPARIHSRYDPQTNQRMPSPPPITTLGHPHSHSHSPAPSDASQD
RSSISTPPVRRSPHLYPPPYQHIQQHPAYMPYPTHFDHHHRYDQDPAHQHAYHPPPQFAIPTMHAPPPPHRDPYH
PYPVPGSQPVTIVHTDDAATKLSDRVRRRCFNCCTTDTSTWRRSNLSPGKVLCNKCGLFERTHSRPRPEQFPHKR
GPLATSTLRGRTPPSNQLPPISPPNANSYYGHAQLQDPRRDQQQSSSQYPPANGSNHNLPALQTWHPNPTSAPPN
GGAPTPTPNSNDGPATSSPHMPPPPVRKATGDSQPQSRQASSSPHLRAAQNTQEVRESGENGA*
Coding >AgabiH97|097200
ATGGCCACATTGGGCTGGCAAGACGAGACGAAAGAGACCAAGGAAGAAGCGATTGACCCAGCGCTGAGAGACTCC
TCCATGTCCGTCAACGTCCACCCCGCCCGCATCCACTCGCGCTACGACCCACAGACCAACCAGCGCATGCCGTCC
CCACCGCCCATCACGACGCTCGGCCACCCCCACTCCCACTCTCACTCGCCCGCCCCGTCGGATGCTTCCCAGGAC
CGCTCGTCCATCTCCACCCCGCCCGTCCGTCGCTCTCCCCATCTCTACCCGCCCCCTTACCAGCACATCCAGCAA
CACCCCGCCTACATGCCTTATCCCACCCACTTTGACCACCACCACCGCTACGACCAGGACCCCGCTCACCAGCAC
GCCTACCACCCTCCCCCCCAGTTTGCTATCCCCACCATGCATGCCCCTCCACCCCCTCACCGCGACCCCTACCAC
CCCTACCCCGTCCCTGGCTCACAGCCCGTCACCATCGTCCACACCGACGACGCCGCCACAAAGCTCAGCGACCGC
GTCCGTCGCAGGTGCTTCAACTGCTGCACCACAGACACCTCCACCTGGCGCAGGTCCAATCTCAGCCCAGGCAAA
GTCTTGTGCAACAAGTGTGGTCTCTTTGAGCGCACGCACTCGCGTCCCCGCCCAGAGCAGTTCCCCCACAAGCGC
GGCCCTCTCGCCACCTCGACCCTCCGAGGTCGCACCCCGCCCTCCAATCAGCTGCCTCCCATCTCTCCCCCCAAT
GCCAACTCGTATTACGGCCACGCTCAGCTCCAAGATCCGAGACGCGATCAACAGCAGAGCTCCTCTCAATATCCC
CCCGCCAACGGCAGCAACCACAACCTCCCCGCCCTCCAGACCTGGCATCCCAATCCCACCTCGGCTCCTCCCAAC
GGCGGCGCCCCTACCCCCACCCCCAATTCAAACGACGGCCCTGCCACCAGCTCTCCTCACATGCCTCCTCCCCCC
GTCAGGAAAGCCACAGGCGACAGTCAGCCCCAAAGCAGGCAGGCCTCTTCCTCTCCTCACCTGAGGGCCGCTCAG
AATACTCAGGAAGTCAGGGAATCCGGTGAAAATGGGGCATAA
Transcript >AgabiH97|097200
ATGGCCACATTGGGCTGGCAAGACGAGACGAAAGAGACCAAGGAAGAAGCGATTGACCCAGCGCTGAGAGACTCC
TCCATGTCCGTCAACGTCCACCCCGCCCGCATCCACTCGCGCTACGACCCACAGACCAACCAGCGCATGCCGTCC
CCACCGCCCATCACGACGCTCGGCCACCCCCACTCCCACTCTCACTCGCCCGCCCCGTCGGATGCTTCCCAGGAC
CGCTCGTCCATCTCCACCCCGCCCGTCCGTCGCTCTCCCCATCTCTACCCGCCCCCTTACCAGCACATCCAGCAA
CACCCCGCCTACATGCCTTATCCCACCCACTTTGACCACCACCACCGCTACGACCAGGACCCCGCTCACCAGCAC
GCCTACCACCCTCCCCCCCAGTTTGCTATCCCCACCATGCATGCCCCTCCACCCCCTCACCGCGACCCCTACCAC
CCCTACCCCGTCCCTGGCTCACAGCCCGTCACCATCGTCCACACCGACGACGCCGCCACAAAGCTCAGCGACCGC
GTCCGTCGCAGGTGCTTCAACTGCTGCACCACAGACACCTCCACCTGGCGCAGGTCCAATCTCAGCCCAGGCAAA
GTCTTGTGCAACAAGTGTGGTCTCTTTGAGCGCACGCACTCGCGTCCCCGCCCAGAGCAGTTCCCCCACAAGCGC
GGCCCTCTCGCCACCTCGACCCTCCGAGGTCGCACCCCGCCCTCCAATCAGCTGCCTCCCATCTCTCCCCCCAAT
GCCAACTCGTATTACGGCCACGCTCAGCTCCAAGATCCGAGACGCGATCAACAGCAGAGCTCCTCTCAATATCCC
CCCGCCAACGGCAGCAACCACAACCTCCCCGCCCTCCAGACCTGGCATCCCAATCCCACCTCGGCTCCTCCCAAC
GGCGGCGCCCCTACCCCCACCCCCAATTCAAACGACGGCCCTGCCACCAGCTCTCCTCACATGCCTCCTCCCCCC
GTCAGGAAAGCCACAGGCGACAGTCAGCCCCAAAGCAGGCAGGCCTCTTCCTCTCCTCACCTGAGGGCCGCTCAG
AATACTCAGGAAGTCAGGGAATCCGGTGAAAATGGGGCATAA
Gene >AgabiH97|097200
ATGGCCACATTGGGCTGGTCAGTTCGTTTATAAACGCTGCGATTCTTGTGCTGACCACCCCCTTTCTGCAGGCAA
GACGAGACGAAAGAGACCAAGGAAGAAGCGATTGACCCAGCGCTGAGAGACGTGAGTTGGCTTTTTGTTGTTGTC
ACTGCTGCCCCTGACACGCTCGCCAGTCCTCCATGTCCGTCAACGTCCACCCCGCCCGCATCCACTCGCGCTACG
ACCCACAGACCAACCAGCGCATGCCGTCCCCACCGCCCATCACGACGCTCGGCCACCCCCACTCCCACTCTCACT
CGCCCGCCCCGTCGGATGCTTCCCAGGACCGCTCGTCCATCTCCACCCCGCCCGTCCGTCGCTCTCCCCATCTCT
ACCCGCCCCCTTACCAGCACATCCAGCAACACCCCGCCTACATGCCTTATCCCACCCACTTTGACCACCACCACC
GCTACGACCAGGACCCCGCTCACCAGCACGCCTACCACCCTCCCCCCCAGTTTGCTATCCCCACCATGCATGCCC
CTCCACCCCCTCACCGCGACCCCTACCACCCCTACCCCGTCCCTGGCTCACAGCCCGTCACCATCGTCCACACCG
ACGACGCCGCCACAAAGCTCAGCGACCGCGTCCGTCGCAGGTGCTTCAACTGCTGCACCACAGACACCTCCACCT
GGCGCAGGTCCAATCTCAGCCCAGGCAAAGTCGTATGTCTTTTTGTTTTTTGTTTCAACCTCGTACTCACTCTTT
CCTAGTTGTGCAACAAGTGTGGTCTCTTTGAGCGCACGCACTCGCGTCCCCGCCCAGAGCAGTTCCCCCACAAGC
GCGGCCCTCTCGCCACCTCGACCCTCCGAGGTCGCACCCCGCCCTCCAATCAGCTGCCTCCCATCTCTCCCCCCA
ATGCCAACTCGTATTACGGCCACGCTCAGCTCCAAGATCCGAGACGCGATCAACAGCAGAGCTCCTCTCAATATC
CCCCCGCCAACGGCAGCAACCACAACCTCCCCGCCCTCCAGACCTGGCATCCCAATCCCACCTCGGCTCCTCCCA
ACGGCGGCGCCCCTACCCCCACCCCCAATTCAAACGACGGCCCTGCCACCAGCTCTCCTCACATGCCTCCTCCCC
CCGTCAGGAAAGCCACAGGCGACAGTCAGCCCCAAAGCAGGCAGGCCTCTTCCTCTCCTCACCTGAGGGCCGCTC
AGAATACTCAGGAAGTCAGGGAATCCGGTGAAAATGGGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail