Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097140
Gene name
Locationscaffold_6:2301856..2304044
Strand-
Gene length (bp)2188
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12051 DUF3533 Protein of unknown function (DUF3533) 9.8E-89 76 439

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46950|SNG1_YEAST Nitrosoguanidine resistance protein SNG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNG1 PE=1 SV=1 64 438 9.0E-24
sp|P47090|YJY5_YEAST Uncharacterized endoplasmic reticulum membrane protein YJR015W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR015W PE=1 SV=1 23 432 8.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 260 282 22
3 303 325 22
4 340 362 22
5 375 397 22
6 428 450 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097140
MYPEMCCNYTLVQESHYRDPLRDQSSITSGKGRRPKVIAEPQSTTQQLYKSGFLSRNADVRGARNLYAKILVGGI
FMIIIIIFTIFPILYGAFYKTPARNLDGWVVDYDDGLIGQSVIAGLMASNQASKISWAVVSKDRFRGGPNEVSNA
VSEHKTWIAVTINSGASTRLTTALENPDPTYDGSQAISIFASEARNENAFRALLLPSVQNTLMVISDRFALQQAQ
AIANSSVLPQLMTTAPRTVLLPISFQLFNIHPFNQPLASVVVTVGLIFVLILSFFVVMIQHGARETTNIPNLLNL
RSLVILRLTSSFFAYFFVSLFLSLLSLAFQLDFTKKFGHAGFFIYWMLILCGMCAMGLALESMLTLLTLKLIPFF
LLLWLMLNVSVSNFPIEILPIFYRFGYALPFYHISKAVRTIVFGTKNQIGFDFAVLLIWTVISCISLTLFQFVVR
RREVINARRKEAQDEMQEAGKAEASS*
Coding >AgabiH97|097140
ATGTATCCGGAAATGTGCTGCAACTACACTTTGGTCCAAGAAAGTCACTACAGAGACCCTTTGCGTGATCAATCG
TCGATCACCAGTGGTAAAGGTCGAAGACCCAAAGTTATTGCTGAGCCGCAATCTACGACTCAACAATTATACAAG
AGCGGGTTTCTTTCTAGAAATGCTGATGTGAGAGGTGCACGAAACTTGTACGCGAAGATTCTCGTTGGCGGGATT
TTCATGATAATTATCATCATTTTTACAATCTTCCCCATTCTTTACGGTGCTTTTTATAAGACACCAGCGCGTAAT
CTTGATGGATGGGTCGTCGACTACGACGACGGTCTGATCGGCCAAAGTGTCATAGCTGGTCTAATGGCGTCGAAT
CAAGCTTCGAAGATAAGCTGGGCGGTTGTTTCAAAGGATCGATTTCGTGGCGGGCCAAATGAGGTCTCTAATGCA
GTCTCCGAACATAAGACATGGATAGCCGTGACAATCAATTCAGGAGCATCTACCAGGCTCACTACGGCACTAGAA
AACCCAGATCCGACGTACGATGGGTCACAAGCCATCTCAATCTTTGCCTCGGAAGCTCGGAACGAAAATGCTTTT
CGCGCGTTGCTCCTTCCCTCTGTTCAAAATACGCTCATGGTCATTTCTGATCGTTTTGCCCTCCAACAAGCTCAG
GCAATAGCTAACTCCTCCGTGCTTCCCCAATTGATGACGACTGCACCCCGGACCGTTCTCTTACCAATATCATTC
CAATTATTTAACATTCACCCCTTTAATCAACCGCTTGCCAGTGTTGTTGTCACCGTCGGATTAATTTTTGTCCTC
ATTCTATCGTTCTTTGTTGTGATGATCCAACACGGAGCTCGTGAAACTACGAATATCCCAAACCTTTTAAATCTA
CGATCCTTGGTCATACTTCGTTTGACTAGCTCTTTCTTCGCTTATTTCTTCGTCTCACTCTTCCTATCACTTCTT
AGTCTGGCATTCCAACTAGATTTTACCAAGAAGTTCGGTCACGCCGGTTTCTTCATCTATTGGATGCTTATTCTA
TGCGGCATGTGTGCTATGGGCCTAGCGCTTGAGTCGATGTTGACACTGCTTACGCTCAAGCTTATTCCTTTCTTC
TTACTGCTTTGGCTCATGCTAAATGTTTCTGTATCAAACTTTCCAATCGAAATTCTCCCGATATTCTATCGTTTC
GGCTACGCCCTACCATTCTACCATATATCCAAAGCCGTTCGCACCATAGTTTTTGGAACCAAAAACCAAATTGGA
TTTGATTTCGCCGTTTTATTGATTTGGACTGTTATTTCGTGCATCTCGCTCACGTTATTCCAATTCGTAGTCCGT
AGGAGGGAGGTAATCAACGCACGGCGAAAAGAGGCGCAAGACGAGATGCAGGAAGCTGGAAAAGCTGAGGCGTCA
AGCTAA
Transcript >AgabiH97|097140
ATGTATCCGGAAATGTGCTGCAACTACACTTTGGTCCAAGAAAGTCACTACAGAGACCCTTTGCGTGATCAATCG
TCGATCACCAGTGGTAAAGGTCGAAGACCCAAAGTTATTGCTGAGCCGCAATCTACGACTCAACAATTATACAAG
AGCGGGTTTCTTTCTAGAAATGCTGATGTGAGAGGTGCACGAAACTTGTACGCGAAGATTCTCGTTGGCGGGATT
TTCATGATAATTATCATCATTTTTACAATCTTCCCCATTCTTTACGGTGCTTTTTATAAGACACCAGCGCGTAAT
CTTGATGGATGGGTCGTCGACTACGACGACGGTCTGATCGGCCAAAGTGTCATAGCTGGTCTAATGGCGTCGAAT
CAAGCTTCGAAGATAAGCTGGGCGGTTGTTTCAAAGGATCGATTTCGTGGCGGGCCAAATGAGGTCTCTAATGCA
GTCTCCGAACATAAGACATGGATAGCCGTGACAATCAATTCAGGAGCATCTACCAGGCTCACTACGGCACTAGAA
AACCCAGATCCGACGTACGATGGGTCACAAGCCATCTCAATCTTTGCCTCGGAAGCTCGGAACGAAAATGCTTTT
CGCGCGTTGCTCCTTCCCTCTGTTCAAAATACGCTCATGGTCATTTCTGATCGTTTTGCCCTCCAACAAGCTCAG
GCAATAGCTAACTCCTCCGTGCTTCCCCAATTGATGACGACTGCACCCCGGACCGTTCTCTTACCAATATCATTC
CAATTATTTAACATTCACCCCTTTAATCAACCGCTTGCCAGTGTTGTTGTCACCGTCGGATTAATTTTTGTCCTC
ATTCTATCGTTCTTTGTTGTGATGATCCAACACGGAGCTCGTGAAACTACGAATATCCCAAACCTTTTAAATCTA
CGATCCTTGGTCATACTTCGTTTGACTAGCTCTTTCTTCGCTTATTTCTTCGTCTCACTCTTCCTATCACTTCTT
AGTCTGGCATTCCAACTAGATTTTACCAAGAAGTTCGGTCACGCCGGTTTCTTCATCTATTGGATGCTTATTCTA
TGCGGCATGTGTGCTATGGGCCTAGCGCTTGAGTCGATGTTGACACTGCTTACGCTCAAGCTTATTCCTTTCTTC
TTACTGCTTTGGCTCATGCTAAATGTTTCTGTATCAAACTTTCCAATCGAAATTCTCCCGATATTCTATCGTTTC
GGCTACGCCCTACCATTCTACCATATATCCAAAGCCGTTCGCACCATAGTTTTTGGAACCAAAAACCAAATTGGA
TTTGATTTCGCCGTTTTATTGATTTGGACTGTTATTTCGTGCATCTCGCTCACGTTATTCCAATTCGTAGTCCGT
AGGAGGGAGGTAATCAACGCACGGCGAAAAGAGGCGCAAGACGAGATGCAGGAAGCTGGAAAAGCTGAGGCGTCA
AGCTAA
Gene >AgabiH97|097140
ATGTATCCGGAAATGTGCTGCAACTACACTGTGAGAAAGACTGTCGCGTAATCCAATCTCGTCATCGGGCACAAT
ATACCTAGTTGGTGTATGTCACCAACGGTAGCCACTCAATGACAGGCGTACAACCAATATAAAGCCAAGGCGAGA
TTCTACTTTTCCATTATACTCCACCTCTGCTTCTTGCTCAATTCCATGTCATCCACAGAAAGTCACTACAGAGAC
CCTTTGCGTGATCAATCGTCGATCACCAGTGGTAAAGGTCGAAGACCCAAAGTTATTGCTGAGCCGCAATCTACG
ACTCAACAATTATACAAGAGCGGGTTTCTTTCTAGAAATGCTGATGTGAGAGGTGCACGAAACTTGTACGCGAAG
ATTCTCGTTGGCGGGATTTTCATGATAATTATCATCATTTTTACAATCTTCCCCATTCTTTACGGTGCTTTTTAT
AAGACACCAGCGCGTAATCTTGATGGATGGGTCGTCGTATGTCAATCGTTCGTTCTCAATGACCCTTTGAACTTA
CTATCGTGACTAGGACTACGACGACGGTCTGATCGGCCAAAGTGTCATAGCTGGTCTAATGGCGTCGAATCAAGC
TTCGAAGATAAGCTGGGCGGTTGTTTCAAAGGATCGATTTCGTGGCGGGCCAAATGAGGTCTCTAATGCAGTCTC
CGAACATAAGACATGGATAGCCGTGACAAGTATGTCCACCTGTCCACCAGCTATTAAAAAGTTAACCCTTGATAC
CCTAGTCAATTCAGGAGCATCTACCAGGCTCACTACGGCACTAGAAAACCCAGATCCGACGTACGATGGGTCACA
AGCCATCTCAATCTTTGCCTCGGAAGCTCGGAACGAAAATGCTTTGTGGGTCTCGTATCGTTTCTGTTCGCACTC
CGCTAATGATGTTGTTGCAGTCGCGCGTTGCTCCTTCCCTCTGTGAGTCCAACTTAAGGCTCTTCGGCAATCGAG
TTAATCCGTTGTATAGGTTCAAAATACGCTCATGGTCATTTCTGATCGTTTTGCCCTCCAACAAGCTCAGGCAAT
AGCTAACTCCTCCGTGCTTCCCCAATTGATGACGACTGCACCCCGGACCGTTCTCTTACCAATATCATTCCAATT
ATTTAACATTCACCCCTTTAATCAACCGCTGTTGGTATTTGATGTGTTTTTTTATCAGTATCAGAGACTTAATCA
CCCTTCTTCAATAGTGCCAGTGTTGTTGTCACCGTCGGATTAATTTTTGTCCTCATTCTATCGTTCTTTGTTGTG
GTACGTATTTCCATAGTTGACCAGACACCTAAAGTTGACTTCAATTTTTTTCCAGATGATCCAACACGGAGCTCG
TGAAACTACGAATATCCCAAACCTTTTAAATCTACGATCCTTGGTCATACTTCGTTTGACTAGCTCTTTCTTCGC
TTATTTCTTCGTCTCAGTAAGTCATTCGACCTGTATTTGCAGATCATATGTTGATTTTTGCCATCGCATAGCTCT
TCCTATCACTTCTTAGTCTGGCATTCCAACTAGATTTTACCAAGAAGTAAGTTTTCGTTGAGCATTCGAGTGTCC
CAGTTTTAATCCACTTTTATAGGTTCGGTCACGCCGGTTTCTTCATCTATTGGATGCTTATTCTATGCGGCATGT
GTGCTATGTGAGGCGTTGCCGATACCACTTGTTTAAATATGAAAGATCTGATCCCAACCATTAGGGGCCTAGCGC
TTGAGTCGATGTTGACACTGCTTACGCTCAAGCTTATTCCTTTCTTCTTACTGCTTTGGCTCATGCGTACGTTTC
CTGTCAAATCTAGGTCCCAACATGGCAGCTGAGAGTCTTTTAGTAAATGTTTCTGTATCAAACTTTCCAATCGAA
ATTCTCCCGATATTCTATCGTTTCGGCTACGCCCTACCATTCTACCATATATCCAAAGCCGTTCGCACCATAGTT
TTTGGAACCAAAAACCAAAGTTCGTTCTATCTGTCGTCCATTACTCTCGAATCTCATATTCACTCATACGATTCT
AGTTGGATTTGATTTCGCCGTTTTATTGATTTGGACTGTTATTTCGTGCATCTCGCTCACGTTATTCCAATTCGT
AGTCCGTAGGAGGGAGGTAATCAACGCACGGCGAAAAGAGGCGCAAGACGAGATGCAGGAAGCTGGAAAAGCTGA
GGCGTCAAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail