Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097060
Gene name
Locationscaffold_6:2275963..2278554
Strand+
Gene length (bp)2591
Transcript length (bp)2241
Coding sequence length (bp)2241
Protein length (aa) 747

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.1E-16 4 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 1 372 1.0E-69
sp|Q9UBZ4|APEX2_HUMAN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens GN=APEX2 PE=1 SV=1 1 390 4.0E-47
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 1 393 4.0E-46
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 1 390 1.0E-41
sp|F4JNY0|APE2_ARATH DNA-(apurinic or apyrimidinic site) lyase 2 OS=Arabidopsis thaliana GN=APE2 PE=1 SV=1 1 396 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 1 372 1.0E-69
sp|Q9UBZ4|APEX2_HUMAN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens GN=APEX2 PE=1 SV=1 1 390 4.0E-47
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 1 393 4.0E-46
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 1 390 1.0E-41
sp|F4JNY0|APE2_ARATH DNA-(apurinic or apyrimidinic site) lyase 2 OS=Arabidopsis thaliana GN=APE2 PE=1 SV=1 1 396 3.0E-38
sp|P38207|APN2_YEAST DNA-(apurinic or apyrimidinic site) lyase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APN2 PE=1 SV=1 1 341 2.0E-36
sp|P27864|RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster GN=Rrp1 PE=1 SV=2 1 339 8.0E-26
sp|P37454|EXOA_BACSU Exodeoxyribonuclease OS=Bacillus subtilis (strain 168) GN=exoA PE=1 SV=1 1 337 8.0E-25
sp|P28352|APEX1_MOUSE DNA-(apurinic or apyrimidinic site) lyase OS=Mus musculus GN=Apex1 PE=1 SV=2 1 341 4.0E-24
sp|P43138|APEX1_RAT DNA-(apurinic or apyrimidinic site) lyase OS=Rattus norvegicus GN=Apex1 PE=1 SV=2 1 341 7.0E-24
sp|A2T6Y4|APEX1_PANTR DNA-(apurinic or apyrimidinic site) lyase OS=Pan troglodytes GN=APEX1 PE=3 SV=1 1 341 2.0E-23
sp|A1YFZ3|APEX1_PANPA DNA-(apurinic or apyrimidinic site) lyase OS=Pan paniscus GN=APEX1 PE=3 SV=1 1 341 2.0E-23
sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens GN=APEX1 PE=1 SV=2 1 341 2.0E-23
sp|A1YES6|APEX1_GORGO DNA-(apurinic or apyrimidinic site) lyase OS=Gorilla gorilla gorilla GN=APEX1 PE=3 SV=1 1 341 9.0E-23
sp|A2T7I6|APEX1_PONPY DNA-(apurinic or apyrimidinic site) lyase OS=Pongo pygmaeus GN=APEX1 PE=3 SV=1 1 341 2.0E-22
sp|P45951|ARP_ARATH DNA-(apurinic or apyrimidinic site) lyase, chloroplastic OS=Arabidopsis thaliana GN=ARP PE=1 SV=2 1 341 3.0E-22
sp|P23196|APEX1_BOVIN DNA-(apurinic or apyrimidinic site) lyase OS=Bos taurus GN=APEX1 PE=1 SV=2 1 341 9.0E-22
sp|A0MTA1|APEX1_DANRE DNA-(apurinic or apyrimidinic site) lyase OS=Danio rerio GN=apex1 PE=1 SV=1 1 341 1.0E-19
sp|P51173|APEA_DICDI DNA-(apurinic or apyrimidinic site) lyase OS=Dictyostelium discoideum GN=apeA PE=2 SV=2 1 341 9.0E-13
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 634 729 3.0E-10
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 603 726 6.0E-09
sp|Q9UBZ4|APEX2_HUMAN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens GN=APEX2 PE=1 SV=1 597 726 9.0E-09
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 643 726 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097060
MRILTWNINGIRTIPQYHPWNSFKDHDEILNNLHSDIICFQEVKSSRAALPKSVAVPPSYHSFFSFPVKKTGYSG
VAVYSRISTVTPLKAEEGLTGLVQPKTPLGPEERVSRWDNYPPHQEYAAAQSENAYEEDGEVDYQLLDGEGRALV
IDFGLFVLINTYCPNDSSTPTTPAAPSPTMSRDKYKKQYHRLLSSRVESLIKNENRQVIVLGDINACAAVIDHCE
GDIMVSRARKANNLEKGDESGFWDCEGTGEGRRWLSDWLQRHDGTGGPMVDIVRRFWPERKGMYTCWNTKLSARE
TNYGTRIDYILVTPGLIPWIEAANIQPEIKGSDHCPVYIDLYDEIAAEDGTSIKLRDVLGNSGEKEPPRLATKFW
EEHSGKQMSLDKFFAGKKAKDLKTPGDCLSPSASQLSGRVSSSSAISTSISNSTTTTTAAPSLQHLESGPLSTAN
SPQPPPSCFSLSRNATGIYPNSLTATSNITSTIIPAPASSSLPPPTAAVPVPTASRTHTSTPSASSQPRKRKNIP
ESQSASLSTSKKKKLLKAAETKKNGQAKLSSYFDKPPPMAKATKASSSSATPGIRSTSFCENDIISVDDDIIDPD
PIPASSSPPSSSQNLASQSSAHTQTKRGKNAHRNEGGSGVGDEIKKEKARQTWNSVFLNANDIPKPKCVAHGEPA
KEYTVNKQGANKGKKFWICARPVGPGYDKGRTERLREEVDPQYRCNFFKWSTDWWKQVKKMSEEEKEGKVS*
Coding >AgabiH97|097060
ATGCGAATACTGACCTGGAATATTAATGGAATTCGGACTATTCCCCAATATCATCCGTGGAATTCATTCAAGGAT
CATGATGAGATTCTTAACAACCTTCACTCGGACATAATCTGTTTCCAAGAAGTGAAATCGTCTCGTGCTGCATTA
CCTAAATCCGTTGCCGTCCCGCCATCCTATCATTCATTCTTTTCATTCCCAGTCAAGAAGACAGGCTATTCAGGC
GTTGCTGTCTACTCGCGTATCAGTACTGTCACGCCACTCAAAGCCGAGGAAGGTCTCACGGGATTGGTTCAGCCA
AAAACTCCACTGGGGCCGGAAGAACGCGTTTCCAGGTGGGACAACTATCCTCCGCATCAAGAATACGCAGCTGCC
CAGAGCGAAAACGCGTACGAAGAAGATGGTGAAGTGGATTATCAGTTATTAGATGGAGAGGGCCGTGCCCTGGTT
ATTGACTTCGGTCTCTTCGTTCTCATCAATACGTATTGTCCGAATGATTCATCCACTCCTACAACTCCCGCCGCA
CCGTCTCCTACTATGTCACGAGACAAATACAAAAAACAGTATCACCGGCTTCTCTCTTCCCGCGTTGAATCTCTC
ATAAAGAACGAAAATCGCCAAGTGATCGTTTTAGGTGATATCAATGCTTGCGCGGCTGTTATCGACCATTGCGAA
GGGGATATCATGGTCTCGAGGGCGAGGAAGGCTAATAATTTAGAAAAAGGTGACGAAAGTGGTTTTTGGGATTGT
GAGGGAACGGGCGAGGGTAGAAGATGGTTGAGTGATTGGTTACAAAGACACGACGGCACCGGAGGCCCGATGGTT
GATATTGTCCGACGATTCTGGCCTGAGAGGAAGGGGATGTATACATGCTGGAATACCAAGCTATCTGCTCGGGAA
ACGAACTATGGAACACGGATAGATTATATCCTCGTTACACCTGGTCTAATCCCTTGGATCGAAGCAGCTAACATT
CAACCCGAAATCAAAGGTAGCGATCATTGCCCCGTGTATATCGACTTGTATGATGAAATTGCGGCCGAAGACGGA
ACGAGCATCAAACTTCGAGACGTACTCGGTAATAGTGGCGAGAAAGAGCCTCCTCGATTGGCAACGAAGTTCTGG
GAGGAACACTCCGGAAAACAGATGTCGTTGGATAAGTTTTTCGCTGGGAAGAAGGCGAAAGACTTGAAAACCCCT
GGTGATTGTCTGTCTCCGTCGGCATCTCAACTCTCGGGGCGAGTTTCGTCCTCCTCTGCAATCTCCACTTCTATT
TCAAATTCCACGACCACCACCACTGCTGCTCCATCGTTGCAGCATCTAGAATCGGGACCTTTATCCACCGCTAAC
TCACCGCAACCTCCGCCTTCTTGTTTTTCCCTCTCACGCAACGCTACCGGCATTTATCCTAACTCTCTCACTGCC
ACCTCCAACATTACAAGTACTATCATTCCCGCACCGGCTTCCTCCAGTCTTCCACCCCCTACCGCCGCCGTTCCT
GTCCCTACCGCTTCTCGTACTCACACCTCAACTCCTTCCGCGTCTTCTCAACCTCGCAAACGAAAAAACATACCT
GAATCCCAATCAGCCTCATTGTCTACGTCCAAGAAGAAGAAATTGTTGAAAGCTGCTGAGACGAAGAAAAATGGT
CAAGCTAAATTATCTTCGTATTTTGATAAACCACCGCCGATGGCGAAGGCGACTAAAGCTTCTTCGAGTTCAGCT
ACTCCTGGGATTCGTTCAACGAGTTTTTGCGAAAATGACATCATTAGTGTTGATGACGATATTATTGACCCGGAT
CCTATTCCTGCATCTTCTTCCCCTCCTTCGTCTTCCCAAAATCTCGCGTCGCAATCATCGGCACATACTCAGACA
AAAAGAGGTAAAAATGCCCACCGGAACGAGGGCGGAAGCGGGGTTGGAGACGAAATCAAGAAAGAAAAGGCCAGA
CAAACCTGGAATAGCGTTTTTCTCAATGCAAACGATATTCCCAAACCAAAATGTGTGGCGCACGGCGAACCCGCG
AAGGAATATACAGTGAACAAACAAGGTGCTAATAAAGGGAAGAAATTCTGGATATGCGCGAGACCCGTTGGTCCC
GGATATGATAAAGGCAGAACTGAGCGGCTGAGAGAAGAGGTCGACCCGCAGTATAGGTGTAATTTCTTCAAGTGG
TCTACTGATTGGTGGAAACAAGTGAAGAAAATGTCCGAAGAGGAGAAAGAGGGAAAGGTTTCGTGA
Transcript >AgabiH97|097060
ATGCGAATACTGACCTGGAATATTAATGGAATTCGGACTATTCCCCAATATCATCCGTGGAATTCATTCAAGGAT
CATGATGAGATTCTTAACAACCTTCACTCGGACATAATCTGTTTCCAAGAAGTGAAATCGTCTCGTGCTGCATTA
CCTAAATCCGTTGCCGTCCCGCCATCCTATCATTCATTCTTTTCATTCCCAGTCAAGAAGACAGGCTATTCAGGC
GTTGCTGTCTACTCGCGTATCAGTACTGTCACGCCACTCAAAGCCGAGGAAGGTCTCACGGGATTGGTTCAGCCA
AAAACTCCACTGGGGCCGGAAGAACGCGTTTCCAGGTGGGACAACTATCCTCCGCATCAAGAATACGCAGCTGCC
CAGAGCGAAAACGCGTACGAAGAAGATGGTGAAGTGGATTATCAGTTATTAGATGGAGAGGGCCGTGCCCTGGTT
ATTGACTTCGGTCTCTTCGTTCTCATCAATACGTATTGTCCGAATGATTCATCCACTCCTACAACTCCCGCCGCA
CCGTCTCCTACTATGTCACGAGACAAATACAAAAAACAGTATCACCGGCTTCTCTCTTCCCGCGTTGAATCTCTC
ATAAAGAACGAAAATCGCCAAGTGATCGTTTTAGGTGATATCAATGCTTGCGCGGCTGTTATCGACCATTGCGAA
GGGGATATCATGGTCTCGAGGGCGAGGAAGGCTAATAATTTAGAAAAAGGTGACGAAAGTGGTTTTTGGGATTGT
GAGGGAACGGGCGAGGGTAGAAGATGGTTGAGTGATTGGTTACAAAGACACGACGGCACCGGAGGCCCGATGGTT
GATATTGTCCGACGATTCTGGCCTGAGAGGAAGGGGATGTATACATGCTGGAATACCAAGCTATCTGCTCGGGAA
ACGAACTATGGAACACGGATAGATTATATCCTCGTTACACCTGGTCTAATCCCTTGGATCGAAGCAGCTAACATT
CAACCCGAAATCAAAGGTAGCGATCATTGCCCCGTGTATATCGACTTGTATGATGAAATTGCGGCCGAAGACGGA
ACGAGCATCAAACTTCGAGACGTACTCGGTAATAGTGGCGAGAAAGAGCCTCCTCGATTGGCAACGAAGTTCTGG
GAGGAACACTCCGGAAAACAGATGTCGTTGGATAAGTTTTTCGCTGGGAAGAAGGCGAAAGACTTGAAAACCCCT
GGTGATTGTCTGTCTCCGTCGGCATCTCAACTCTCGGGGCGAGTTTCGTCCTCCTCTGCAATCTCCACTTCTATT
TCAAATTCCACGACCACCACCACTGCTGCTCCATCGTTGCAGCATCTAGAATCGGGACCTTTATCCACCGCTAAC
TCACCGCAACCTCCGCCTTCTTGTTTTTCCCTCTCACGCAACGCTACCGGCATTTATCCTAACTCTCTCACTGCC
ACCTCCAACATTACAAGTACTATCATTCCCGCACCGGCTTCCTCCAGTCTTCCACCCCCTACCGCCGCCGTTCCT
GTCCCTACCGCTTCTCGTACTCACACCTCAACTCCTTCCGCGTCTTCTCAACCTCGCAAACGAAAAAACATACCT
GAATCCCAATCAGCCTCATTGTCTACGTCCAAGAAGAAGAAATTGTTGAAAGCTGCTGAGACGAAGAAAAATGGT
CAAGCTAAATTATCTTCGTATTTTGATAAACCACCGCCGATGGCGAAGGCGACTAAAGCTTCTTCGAGTTCAGCT
ACTCCTGGGATTCGTTCAACGAGTTTTTGCGAAAATGACATCATTAGTGTTGATGACGATATTATTGACCCGGAT
CCTATTCCTGCATCTTCTTCCCCTCCTTCGTCTTCCCAAAATCTCGCGTCGCAATCATCGGCACATACTCAGACA
AAAAGAGGTAAAAATGCCCACCGGAACGAGGGCGGAAGCGGGGTTGGAGACGAAATCAAGAAAGAAAAGGCCAGA
CAAACCTGGAATAGCGTTTTTCTCAATGCAAACGATATTCCCAAACCAAAATGTGTGGCGCACGGCGAACCCGCG
AAGGAATATACAGTGAACAAACAAGGTGCTAATAAAGGGAAGAAATTCTGGATATGCGCGAGACCCGTTGGTCCC
GGATATGATAAAGGCAGAACTGAGCGGCTGAGAGAAGAGGTCGACCCGCAGTATAGGTGTAATTTCTTCAAGTGG
TCTACTGATTGGTGGAAACAAGTGAAGAAAATGTCCGAAGAGGAGAAAGAGGGAAAGGTTTCGTGA
Gene >AgabiH97|097060
ATGCGAATACTGACCTGGAATATTGTGAGTTGTCTTTTGTAATGCTTAATTCTGTATTGATCAGAGACCATAGAA
TGGAATTCGGACTATTCCCCAATATCATCCGTATGTCAACGCTCTTGGCTGAAAGCTCCGCGTTGTACTAACTGC
TGCCCAGGTGGAATTCATTCAAGGATCATGATGAGATTCTTAACAACCTTCACTCGGACATAATCTGTTTCCAAG
GTGCGCGTCGTCCTTTATCCACGTCAACTCCTAATTGACGTCTGTTCTAGAAGTGAAATCGTCTCGTGCTGCATT
ACCTAAATCCGTTGCCGTCCCGCCATCCTATCATTCATTCTTTTCATTCCCAGTCAAGAAGACAGGCTATTCAGG
CGTTGCTGTCTACTCGCGTATCAGTACTGTCACGCCACTCAAAGCCGAGGAAGGTCTCACGGGATTGGTTCAGCC
AAAAACTCCACTGGGGCCGGAAGAACGCGTTTCCAGGTGGGACAACTATCCTCCGCATCAAGAATACGCAGCTGC
CCAGAGCGAAAACGCGTACGAAGAAGATGGTGAAGTGGATTATCAGTTATTAGATGGAGAGGGCCGTGCCCTGGT
TATTGACTTCGGTCTCTTCGTTCTCATCAATACGTATTGTCCGAATGATTCATCCACTCCTACAACTCCCGCCGC
ACCGTCTCCTACTATGTCACGAGACAAATACAAAAAACAGTATCACCGGCTTCTCTCTTCCCGCGTTGAATCTCT
CATAAAGAACGAAAATCGCCAAGTGATCGTTTTAGGTGATATCAATGCTTGCGCGGCTGTTATCGACCATTGCGA
AGGGGATATCATGGTCTCGAGGGCGAGGAAGGCTAATAATTTAGAAAAAGGTGACGAAAGTGGTTTTTGGGATTG
TGAGGGAACGGGCGAGGGTAGAAGATGGTTGAGTGATTGGTTACAAAGACACGACGGCACCGGAGGCCCGATGGT
TGATATTGTCCGACGATTCTGGCCTGAGAGGAAGGGGATGTATACATGTACGTTTGTCTTGGGGGTCGCCTCCCT
CTAACTAACTCATAGCTGAGGTTTTCCATTTTTGATCGTCAGGCTGGAATACCAAGCTATCTGCTCGGGAAACGA
ACTATGGAACACGGATAGATTATATCCTCGTTACACCTGGTCTAATCCCTTGGATCGAAGCAGCTAACATTCAAC
CCGAAATCAAAGGTAGCGATCATTGCCCCGTGTATATCGACTTGTATGATGAAATTGCGGCCGAAGACGGAACGA
GCATCAAACTTCGAGACGTACTCGGTAATAGTGGCGAGAAAGAGCCTCCTCGATTGGCAACGAAGTTCTGGGAGG
AACACTCCGGAAAACAGATGTCGTTGGATAAGTTTTTCGCTGGGAAGAAGGCGAAAGACTTGAAAACCCCTGGTG
ATTGTCTGTCTCCGTCGGCATCTCAACTCTCGGGGCGAGTTTCGTCCTCCTCTGCAATCTCCACTTCTATTTCAA
ATTCCACGACCACCACCACTGCTGCTCCATCGTTGCAGCATCTAGAATCGGGACCTTTATCCACCGCTAACTCAC
CGCAACCTCCGCCTTCTTGTTTTTCCCTCTCACGCAACGCTACCGGCATTTATCCTAACTCTCTCACTGCCACCT
CCAACATTACAAGTACTATCATTCCCGCACCGGCTTCCTCCAGTCTTCCACCCCCTACCGCCGCCGTTCCTGTCC
CTACCGCTTCTCGTACTCACACCTCAACTCCTTCCGCGTCTTCTCAACCTCGCAAACGAAAAAACATACCTGAAT
CCCAATCAGCCTCATTGTCTACGTCCAAGAAGAAGAAATTGTTGAAAGCTGCTGAGACGAAGAAAAATGGTCAAG
CTAAATTATCTTCGTATTTTGATAAACCACCGCCGATGGCGAAGGCGACTAAAGCTTCTTCGAGTTCAGCTACTC
CTGGGATTCGTTCAACGAGTTTTTGCGAAAATGACATCATTAGTGTTGATGACGATATTATTGACCCGGATCCTA
TTCCTGCATCTTCTTCCCCTCCTTCGTCTTCCCAAAATCTCGCGTCGCAATCATCGGCACATACTCAGACAAAAA
GAGGTAAAAATGCCCACCGGAACGAGGGCGGAAGCGGGGTTGGAGACGAAATCAAGAAAGAAAAGGCCAGACAAA
CCTGGAATAGCGTTTTTCTCAATGCAAACGATATTCCCAAACCAAAATGTGTGGCGCACGGCGAACCCGCGAAGG
AATATACAGTGAACAAACAAGGTGCTAATAAAGGGAAGAAATTCTGGATATGCGCGAGGTGAGTTGTTGATTAGA
TACGGCAGGTTCCCCGTTCTTGCGCTCATAAAGGCCGTACACCCATCTTTCTATATTTCTTCTCACCTTTCTGAG
TATCTCTGGTTTTTCAAACTAAACTTTTCCACTTTAGACCCGTTGGTCCCGGATATGATAAAGGCAGAACTGAGC
GGCTGAGAGAAGAGGTCGACCCGCAGTATAGGTGTAATTTCTTCAAGTGGTCTACTGATTGGTGGAAACAAGTGA
AGAAAATGTCCGAAGAGGAGAAAGAGGGAAAGGTTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail