Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097020
Gene name
Locationscaffold_6:2267825..2269376
Strand+
Gene length (bp)1551
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 6.9E-06 120 164
PF13418 Kelch_4 Galactose oxidase, central domain 3.5E-04 170 215
PF13418 Kelch_4 Galactose oxidase, central domain 1.4E-05 315 360
PF13854 Kelch_5 Kelch motif 8.2E-06 165 200
PF13854 Kelch_5 Kelch motif 3.8E-05 216 251
PF13854 Kelch_5 Kelch motif 8.9E-06 409 445
PF01344 Kelch_1 Kelch motif 7.2E-06 167 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 103 444 3.0E-19
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 153 450 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 204 450 6.0E-16
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 163 448 6.0E-16
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 120 388 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 103 444 3.0E-19
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 153 450 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 204 450 6.0E-16
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 163 448 6.0E-16
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 120 388 7.0E-16
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 110 435 1.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 110 435 4.0E-15
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 110 435 5.0E-15
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 103 390 1.0E-14
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 103 390 2.0E-14
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 103 390 2.0E-14
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 101 258 3.0E-14
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 129 420 3.0E-14
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 120 448 3.0E-14
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 96 435 4.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 129 409 6.0E-14
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 120 448 7.0E-14
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 120 448 7.0E-14
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 103 250 1.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 82 258 2.0E-13
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 209 450 2.0E-13
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 96 435 6.0E-13
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 310 456 9.0E-13
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 104 347 3.0E-12
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 120 396 7.0E-12
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 120 380 9.0E-12
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 129 380 1.0E-11
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 131 396 3.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 166 448 3.0E-11
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 103 264 3.0E-11
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 151 404 3.0E-11
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 99 454 4.0E-11
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 143 449 5.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 92 333 2.0E-10
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 103 386 2.0E-10
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 103 264 2.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 150 427 3.0E-10
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 103 251 4.0E-10
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 103 254 5.0E-10
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 210 430 5.0E-10
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 103 251 5.0E-10
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 119 404 7.0E-10
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 87 238 9.0E-10
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 298 446 9.0E-10
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 103 367 9.0E-10
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 143 444 9.0E-10
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 103 251 9.0E-10
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 143 444 1.0E-09
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 204 430 2.0E-09
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 101 446 2.0E-09
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 103 401 2.0E-09
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 103 401 2.0E-09
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 204 430 3.0E-09
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 147 448 3.0E-09
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 109 341 3.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 312 430 3.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 120 241 4.0E-09
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 57 251 4.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 198 464 4.0E-09
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 204 430 5.0E-09
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 103 251 5.0E-09
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 144 380 6.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 216 464 9.0E-09
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 74 394 1.0E-08
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 103 333 1.0E-08
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 103 333 1.0E-08
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 38 226 2.0E-08
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 301 446 2.0E-08
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 57 251 2.0E-08
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 103 333 4.0E-08
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 312 446 4.0E-08
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 103 251 4.0E-08
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 119 355 4.0E-08
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 103 402 4.0E-08
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 211 446 5.0E-08
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 103 251 7.0E-08
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 217 380 9.0E-08
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 312 450 1.0E-07
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 119 439 1.0E-07
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 103 247 2.0E-07
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 111 238 2.0E-07
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 276 441 2.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 129 384 2.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 216 464 2.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 216 464 2.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 120 251 2.0E-07
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 300 438 2.0E-07
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 297 464 3.0E-07
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 103 355 3.0E-07
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 103 252 4.0E-07
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 103 244 4.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 298 450 6.0E-07
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 215 464 6.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 131 261 7.0E-07
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 103 397 7.0E-07
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 103 260 9.0E-07
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 103 349 9.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 120 424 1.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 129 238 1.0E-06
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 103 350 1.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 110 236 1.0E-06
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 103 251 1.0E-06
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 103 349 1.0E-06
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 103 346 1.0E-06
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 215 445 2.0E-06
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 103 236 2.0E-06
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 103 244 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 293 464 2.0E-06
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 103 255 2.0E-06
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 87 236 2.0E-06
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 120 252 3.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 129 384 3.0E-06
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 327 442 4.0E-06
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 129 264 4.0E-06
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 104 251 4.0E-06
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 104 251 4.0E-06
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 167 459 5.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 299 444 8.0E-06
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 215 464 9.0E-06
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 149 447 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097020
MDRLSVNTTGTARKASSLRSLAVSASDSPSEQPRTSLRRAASSNLTPSSAPSTPSIHTPRQTSSSSSSRYHHRGD
AHIPRMKSTPRLVYDKDAEQAPSTGMYWSRAPVYGAIPNRSMRAHSITVIDNVVWLFGGCDDRESWKDIYCLNVE
SMQWTHPECLGDTPPPSRAHSATLVANHKIVFIGGGHGSVYYDSVYVLDTLTRRWSRPTIAPGPSPPQRRAHTAV
LYENKIWVFGGGNGMMALDDVWTLDVAPLTGAIGGGTGSGGYHGVYHVGGGGFYGPYAPSSSSSGKTKDGNVTLT
WDLVETKGIKKPESRGYHTANLVGNIMVIIGGSDGKDSFDELWTLNLDTLVWTQIKTNIPYRRLAHSSTQVGSYL
FIFGGHDSTEYTSELVLLNLVSLQYETRPVYGKVPSPRGYHATALADSRVLLIGGFNGHQSFDDVHILELAASAY
LPQVTSFAIEALIP*
Coding >AgabiH97|097020
ATGGACAGGCTCAGCGTGAACACGACGGGCACAGCGCGCAAAGCATCCAGCCTACGGTCTCTCGCTGTCAGCGCC
AGCGACTCTCCCTCCGAACAACCCCGCACTTCGCTCAGGCGAGCAGCATCCAGTAATCTCACCCCTTCCAGCGCC
CCTTCGACACCCTCCATCCACACTCCTCGCCAAACTTCGTCGTCGTCATCATCTCGCTATCACCATAGAGGTGAT
GCACACATTCCTAGAATGAAGTCTACACCCCGACTCGTGTACGACAAGGACGCCGAACAGGCCCCAAGTACCGGT
ATGTATTGGAGTCGCGCCCCAGTCTACGGTGCCATTCCGAATCGAAGTATGCGCGCGCACAGTATCACTGTCATT
GATAATGTCGTCTGGCTGTTTGGTGGATGTGATGATAGGGAGAGTTGGAAAGATATCTATTGTTTGAATGTCGAA
TCCATGCAATGGACACATCCTGAATGTCTGGGCGACACGCCTCCTCCATCGCGAGCTCACTCCGCAACACTCGTC
GCCAACCACAAAATTGTATTCATCGGCGGAGGCCACGGTTCAGTATATTATGATTCCGTATACGTCCTCGATACA
CTCACACGTCGGTGGTCTCGCCCAACAATTGCTCCAGGTCCTTCACCACCTCAAAGAAGAGCTCATACAGCCGTA
CTGTATGAAAATAAAATTTGGGTTTTTGGAGGTGGGAATGGTATGATGGCTCTGGATGATGTTTGGACTCTGGAT
GTTGCGCCTTTGACGGGTGCTATAGGCGGAGGAACTGGATCCGGAGGATATCATGGTGTATATCACGTCGGTGGT
GGTGGTTTCTATGGACCTTATGCACCCAGTTCTTCATCAAGTGGGAAGACCAAAGACGGTAATGTCACTCTGACA
TGGGATTTGGTCGAGACGAAGGGTATAAAAAAACCTGAATCGAGAGGTTATCATACCGCTAATCTTGTAGGAAAT
ATCATGGTCATCATCGGAGGAAGTGACGGAAAAGATTCTTTCGACGAACTCTGGACTCTAAACCTCGATACACTC
GTATGGACACAAATCAAAACCAACATTCCATATAGACGCTTGGCACACAGCTCAACTCAAGTCGGTTCTTATTTA
TTCATATTCGGTGGTCATGACAGTACCGAATATACATCTGAACTCGTTCTCCTTAACCTCGTTTCACTGCAATAC
GAAACTCGGCCTGTTTACGGAAAAGTTCCATCTCCACGAGGATATCACGCTACAGCGCTCGCAGACAGTAGAGTT
CTATTAATCGGGGGTTTTAATGGTCATCAGTCCTTTGATGATGTACACATTTTGGAGTTGGCGGCTAGTGCGTAT
TTGCCACAGGTTACGAGTTTTGCTATCGAGGCGTTGATACCTTGA
Transcript >AgabiH97|097020
ATGGACAGGCTCAGCGTGAACACGACGGGCACAGCGCGCAAAGCATCCAGCCTACGGTCTCTCGCTGTCAGCGCC
AGCGACTCTCCCTCCGAACAACCCCGCACTTCGCTCAGGCGAGCAGCATCCAGTAATCTCACCCCTTCCAGCGCC
CCTTCGACACCCTCCATCCACACTCCTCGCCAAACTTCGTCGTCGTCATCATCTCGCTATCACCATAGAGGTGAT
GCACACATTCCTAGAATGAAGTCTACACCCCGACTCGTGTACGACAAGGACGCCGAACAGGCCCCAAGTACCGGT
ATGTATTGGAGTCGCGCCCCAGTCTACGGTGCCATTCCGAATCGAAGTATGCGCGCGCACAGTATCACTGTCATT
GATAATGTCGTCTGGCTGTTTGGTGGATGTGATGATAGGGAGAGTTGGAAAGATATCTATTGTTTGAATGTCGAA
TCCATGCAATGGACACATCCTGAATGTCTGGGCGACACGCCTCCTCCATCGCGAGCTCACTCCGCAACACTCGTC
GCCAACCACAAAATTGTATTCATCGGCGGAGGCCACGGTTCAGTATATTATGATTCCGTATACGTCCTCGATACA
CTCACACGTCGGTGGTCTCGCCCAACAATTGCTCCAGGTCCTTCACCACCTCAAAGAAGAGCTCATACAGCCGTA
CTGTATGAAAATAAAATTTGGGTTTTTGGAGGTGGGAATGGTATGATGGCTCTGGATGATGTTTGGACTCTGGAT
GTTGCGCCTTTGACGGGTGCTATAGGCGGAGGAACTGGATCCGGAGGATATCATGGTGTATATCACGTCGGTGGT
GGTGGTTTCTATGGACCTTATGCACCCAGTTCTTCATCAAGTGGGAAGACCAAAGACGGTAATGTCACTCTGACA
TGGGATTTGGTCGAGACGAAGGGTATAAAAAAACCTGAATCGAGAGGTTATCATACCGCTAATCTTGTAGGAAAT
ATCATGGTCATCATCGGAGGAAGTGACGGAAAAGATTCTTTCGACGAACTCTGGACTCTAAACCTCGATACACTC
GTATGGACACAAATCAAAACCAACATTCCATATAGACGCTTGGCACACAGCTCAACTCAAGTCGGTTCTTATTTA
TTCATATTCGGTGGTCATGACAGTACCGAATATACATCTGAACTCGTTCTCCTTAACCTCGTTTCACTGCAATAC
GAAACTCGGCCTGTTTACGGAAAAGTTCCATCTCCACGAGGATATCACGCTACAGCGCTCGCAGACAGTAGAGTT
CTATTAATCGGGGGTTTTAATGGTCATCAGTCCTTTGATGATGTACACATTTTGGAGTTGGCGGCTAGTGCGTAT
TTGCCACAGGTTACGAGTTTTGCTATCGAGGCGTTGATACCTTGA
Gene >AgabiH97|097020
ATGGACAGGCTCAGCGTGAACACGACGGGCACAGCGCGCAAAGCATCCAGCCTACGGTCTCTCGCTGTCAGCGCC
AGCGACTCTCCCTCCGAACAACCCCGCACTTCGCTCAGGCGAGCAGCATCCAGTAATCTCACCCCTTCCAGCGCC
CCTTCGACACCCTCCATCCACACTCCTCGCCAAACTTCGTCGTCGTCATCATCTCGCTATCACCATAGAGGTGAT
GCACACATTCCTAGAATGAAGTCTACACCCCGACTCGTGTACGACAAGGACGCCGAACAGGCCCCAAGTACCGGT
ATGTATTGGAGTCGCGCCCCAGTCTACGGTGCCATTCCGAATCGAAGTATGCGCGCGCACAGTATCACTGTCATT
GATAATGTCGTCTGGCTGTTTGGTGGATGTGATGATAGGGAGAGTTGGAAAGATATCTATTGTTTGAATGTCGGT
GCGTGCATAACCTGTGCCAAAATCATAAACAAATTTATTCTGCATATATATATAGAATCCATGCAATGGACACAT
CCTGAATGTCTGGGCGACACGCCTCCTCCATCGCGAGCTCACTCCGCAACACTCGTCGCCAACCACAAAATTGTA
TTCATCGGCGGAGGCCACGGTTCAGTATATTATGATTCCGTATACGTCCTCGATACACTCACACGTCGGTGGTCT
CGCCCAACAATTGCTCCAGGTCCTTCACCACCTCAAAGAAGAGCTCATACAGCCGTACTGTATGAAAATAAAATT
TGGGTTTTTGGAGGTGGGAATGGTATGATGGCTCTGGATGATGTTTGGACTCTGGATGTTGCGCCTTTGACGGGT
GCTATAGGCGGAGGAACTGGATCCGGAGGATATCATGGTGTATATCACGTCGGTGGTGGTGGTTTCTATGGACCT
TATGCACCCAGTTCTTCATCAAGTGGGAAGACCAAAGACGGTAATGTCACTCTGACATGGGATTTGGTCGAGACG
AAGGGTATAAAAAAACCTGAATCGAGAGGTTATCATACCGCTAATCTTGTAGGAAATATCATGGTCATCATCGGA
GGAAGTGACGGAAAAGATTCTTTCGACGAACTCTGGACTCTAAACCTCGGTACGTTTGGTCTTTCCTTCCCCCTT
TTTTCAATTCACTTAATCGCGCATAGATACACTCGTATGGACACAAATCAAAACCAACATTCCATATAGACGCTT
GGCACACAGCTCAACTCAAGTCGGTTCTTATTTATTCATATTCGGTGGTCATGACAGTACCGAATATACATCTGA
ACTCGTTCTCCTTAACCTCGGTAACGTTTCCTCTTTTATTTTGACCGCATATATTGATACAAATTAGTTTCACTG
CAATACGAAACTCGGCCTGTTTACGGAAAAGTTCCATCTCCACGAGGATATCACGCTACAGCGCTCGCAGACAGT
AGAGTTCTATTAATCGGGGGTTTTAATGGTCATCAGTCCTTTGATGATGTACACATTTTGGAGTTGGCGGCTAGT
GCGTATTTGCCACAGGTTACGAGTTTTGCTATCGAGGCGTTGATACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail