Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|097000
Gene name
Locationscaffold_6:2261379..2263382
Strand-
Gene length (bp)2003
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-38 43 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 46 462 4.0E-30
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 32 511 5.0E-29
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 48 456 5.0E-28
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 48 456 5.0E-28
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 20 491 9.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 46 462 4.0E-30
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 32 511 5.0E-29
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 48 456 5.0E-28
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 48 456 5.0E-28
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 20 491 9.0E-26
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 6 463 3.0E-24
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 6 463 3.0E-24
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 60 453 3.0E-22
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 44 345 4.0E-22
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 60 456 6.0E-22
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 60 453 1.0E-21
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 13 446 2.0E-18
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 34 305 1.0E-17
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 34 461 3.0E-17
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 29 453 5.0E-17
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 32 455 7.0E-17
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 32 455 7.0E-17
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 449 8.0E-17
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 11 512 8.0E-17
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 67 461 1.0E-16
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 20 462 1.0E-16
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 23 461 2.0E-16
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 23 461 2.0E-16
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 64 479 4.0E-16
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 1 492 5.0E-16
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 32 509 4.0E-15
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 34 450 7.0E-15
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 67 461 8.0E-15
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 32 508 1.0E-14
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 32 508 1.0E-14
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 32 449 3.0E-14
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 43 449 3.0E-14
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 35 481 4.0E-14
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 38 461 4.0E-14
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 35 456 2.0E-13
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 49 461 4.0E-13
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 47 461 1.0E-12
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 30 311 2.0E-12
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 48 304 2.0E-12
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 30 311 3.0E-12
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 44 462 4.0E-12
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 6 369 1.0E-11
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 33 313 3.0E-11
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 32 449 5.0E-11
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 32 309 2.0E-10
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 16 231 2.0E-10
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 32 308 3.0E-10
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 34 260 4.0E-10
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 45 449 4.0E-10
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 34 260 4.0E-10
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 34 260 4.0E-10
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 32 308 5.0E-10
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 25 335 5.0E-10
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 32 309 5.0E-10
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 34 260 6.0E-10
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 32 309 8.0E-10
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 43 260 8.0E-10
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 48 260 8.0E-10
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 16 207 9.0E-10
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 35 198 9.0E-10
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 32 309 1.0E-09
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 32 309 1.0E-09
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 55 249 1.0E-09
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 55 249 1.0E-09
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 32 449 1.0E-09
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 32 309 1.0E-09
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 32 309 2.0E-09
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 32 309 2.0E-09
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 32 309 3.0E-09
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 32 309 3.0E-09
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 32 309 3.0E-09
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 32 309 3.0E-09
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 32 309 4.0E-09
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 32 309 4.0E-09
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 34 309 4.0E-09
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 32 309 5.0E-09
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 32 309 1.0E-08
sp|Q8BN82|S17A5_MOUSE Sialin OS=Mus musculus GN=Slc17a5 PE=1 SV=2 114 228 1.0E-08
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 96 236 2.0E-08
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 60 208 1.0E-07
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 60 208 1.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 73 453 1.0E-07
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 18 309 3.0E-07
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 74 410 3.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 48 252 3.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 43 379 6.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 35 257 7.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 35 257 7.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 35 257 7.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 35 257 8.0E-07
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 33 318 3.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 33 318 3.0E-06
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 39 465 3.0E-06
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 32 205 3.0E-06
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 55 231 3.0E-06
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 60 465 4.0E-06
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 1 225 5.0E-06
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 33 197 6.0E-06
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 173 453 1.0E-05
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 43 248 1.0E-05
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 43 248 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 75 92 17
3 104 123 19
4 130 152 22
5 165 187 22
6 192 214 22
7 235 254 19
8 259 281 22
9 302 324 22
10 339 361 22
11 368 387 19
12 397 419 22
13 472 491 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|097000
MSEAAHSAAPSHTSEKTVTDPPKPNDPLAALSLRRKIALTAFLCLAQFLDTFANSALFAAFPPISLELGISNSNA
VWIISGYQLTFAALLLGSGRMSDLFNPKYVFLSGAALLSVFSLGTGFAKDEVTLFILRAFMGVGAALTVPSALHL
IVHLFPDPMQQTKAIALFGSFGAIGNVIGLIIGALIIQWATWPWLFYVFTIVGAVVFVAVAILSPSPERVVVLSN
MQRFKRLDLGGIFLVTAGLVLFIFGVTAGSVNGWTSARCLAPLIISVFPIAAFFFWEAQLPEEQAAIPPSLWRVR
NFTILVVGSATVHYWWFGVVQILFSWVWQNVYHWSPLITALHFLPLGAFAGLVTVTISSFRKYFPLKWILISAQV
LALVATLLLTFGDSPQRYFPFVFPGFILGAFGVATAYLTVNIAVFASTPPEKAGVVGSIFNCFEQVGSAAGSAII
TSIQTSVEVNHGGPNSFFGRRVGLWFLFGLVAISTLSLLIFMHNDIPPSKTVITDNERGLDAPVEKDSETVAKDE
K*
Coding >AgabiH97|097000
ATGTCCGAAGCTGCTCACTCCGCCGCACCCTCCCATACTTCTGAGAAGACTGTAACAGATCCTCCTAAACCAAAC
GACCCGCTGGCTGCGCTCTCTTTGCGACGAAAAATTGCTCTTACAGCGTTCCTATGTCTAGCTCAATTCCTCGAC
ACTTTCGCCAACTCAGCTCTCTTTGCTGCCTTCCCTCCCATTTCATTGGAACTCGGCATCTCGAACAGCAATGCT
GTCTGGATTATAAGCGGTTATCAGCTTACTTTTGCGGCACTTCTGCTCGGTAGCGGACGAATGAGCGATTTGTTC
AATCCTAAGTATGTCTTCTTATCGGGAGCTGCATTGCTTTCGGTATTCTCCTTGGGCACTGGATTCGCCAAAGAC
GAAGTTACTTTGTTTATCCTCCGCGCTTTTATGGGTGTCGGAGCTGCTTTGACAGTCCCTTCCGCGCTACATCTC
ATCGTTCATCTATTCCCGGACCCAATGCAACAGACAAAAGCCATTGCCCTGTTCGGAAGCTTCGGAGCTATAGGT
AACGTGATCGGGCTTATTATTGGCGCTCTCATTATCCAATGGGCAACTTGGCCGTGGCTTTTCTACGTTTTTACC
ATAGTTGGAGCAGTCGTATTCGTCGCTGTGGCCATTTTATCACCTTCTCCTGAGCGTGTCGTCGTTCTTAGTAAC
ATGCAACGCTTCAAACGTCTCGATCTTGGTGGGATCTTCCTGGTGACTGCTGGCCTCGTACTTTTCATATTCGGT
GTGACAGCCGGTTCGGTGAATGGTTGGACAAGCGCGCGATGCTTGGCTCCGCTGATCATTTCAGTGTTTCCGATC
GCTGCATTCTTCTTCTGGGAAGCGCAACTTCCCGAAGAACAAGCTGCTATTCCTCCGAGTCTCTGGCGAGTGAGA
AACTTCACAATCCTCGTTGTAGGATCTGCGACTGTGCATTACTGGTGGTTTGGAGTTGTGCAGATCTTGTTCTCG
TGGGTCTGGCAAAATGTTTATCACTGGTCTCCCCTCATTACCGCCCTTCATTTCCTTCCCCTCGGGGCATTTGCC
GGTCTAGTAACGGTTACGATCAGCTCTTTCCGGAAATATTTTCCGCTAAAATGGATCCTAATCTCTGCGCAAGTT
CTCGCCTTGGTTGCAACATTACTTTTGACTTTTGGTGACTCACCACAACGCTATTTCCCTTTCGTATTTCCTGGA
TTCATTCTGGGAGCGTTTGGGGTTGCGACGGCCTATCTAACAGTCAACATTGCTGTGTTTGCTTCTACGCCACCC
GAGAAAGCTGGTGTGGTAGGCTCCATCTTCAACTGTTTCGAACAGGTTGGAAGCGCAGCTGGAAGTGCTATAATA
ACTTCTATCCAGACAAGTGTTGAAGTAAATCATGGCGGACCTAACTCATTCTTTGGACGAAGAGTCGGTCTTTGG
TTTCTATTCGGATTAGTTGCCATCAGCACCCTATCCCTCCTCATATTCATGCACAACGACATTCCCCCGAGCAAA
ACGGTGATCACAGATAACGAAAGAGGCTTGGATGCGCCTGTGGAGAAAGACTCAGAGACGGTCGCGAAGGATGAA
AAATAG
Transcript >AgabiH97|097000
ATGTCCGAAGCTGCTCACTCCGCCGCACCCTCCCATACTTCTGAGAAGACTGTAACAGATCCTCCTAAACCAAAC
GACCCGCTGGCTGCGCTCTCTTTGCGACGAAAAATTGCTCTTACAGCGTTCCTATGTCTAGCTCAATTCCTCGAC
ACTTTCGCCAACTCAGCTCTCTTTGCTGCCTTCCCTCCCATTTCATTGGAACTCGGCATCTCGAACAGCAATGCT
GTCTGGATTATAAGCGGTTATCAGCTTACTTTTGCGGCACTTCTGCTCGGTAGCGGACGAATGAGCGATTTGTTC
AATCCTAAGTATGTCTTCTTATCGGGAGCTGCATTGCTTTCGGTATTCTCCTTGGGCACTGGATTCGCCAAAGAC
GAAGTTACTTTGTTTATCCTCCGCGCTTTTATGGGTGTCGGAGCTGCTTTGACAGTCCCTTCCGCGCTACATCTC
ATCGTTCATCTATTCCCGGACCCAATGCAACAGACAAAAGCCATTGCCCTGTTCGGAAGCTTCGGAGCTATAGGT
AACGTGATCGGGCTTATTATTGGCGCTCTCATTATCCAATGGGCAACTTGGCCGTGGCTTTTCTACGTTTTTACC
ATAGTTGGAGCAGTCGTATTCGTCGCTGTGGCCATTTTATCACCTTCTCCTGAGCGTGTCGTCGTTCTTAGTAAC
ATGCAACGCTTCAAACGTCTCGATCTTGGTGGGATCTTCCTGGTGACTGCTGGCCTCGTACTTTTCATATTCGGT
GTGACAGCCGGTTCGGTGAATGGTTGGACAAGCGCGCGATGCTTGGCTCCGCTGATCATTTCAGTGTTTCCGATC
GCTGCATTCTTCTTCTGGGAAGCGCAACTTCCCGAAGAACAAGCTGCTATTCCTCCGAGTCTCTGGCGAGTGAGA
AACTTCACAATCCTCGTTGTAGGATCTGCGACTGTGCATTACTGGTGGTTTGGAGTTGTGCAGATCTTGTTCTCG
TGGGTCTGGCAAAATGTTTATCACTGGTCTCCCCTCATTACCGCCCTTCATTTCCTTCCCCTCGGGGCATTTGCC
GGTCTAGTAACGGTTACGATCAGCTCTTTCCGGAAATATTTTCCGCTAAAATGGATCCTAATCTCTGCGCAAGTT
CTCGCCTTGGTTGCAACATTACTTTTGACTTTTGGTGACTCACCACAACGCTATTTCCCTTTCGTATTTCCTGGA
TTCATTCTGGGAGCGTTTGGGGTTGCGACGGCCTATCTAACAGTCAACATTGCTGTGTTTGCTTCTACGCCACCC
GAGAAAGCTGGTGTGGTAGGCTCCATCTTCAACTGTTTCGAACAGGTTGGAAGCGCAGCTGGAAGTGCTATAATA
ACTTCTATCCAGACAAGTGTTGAAGTAAATCATGGCGGACCTAACTCATTCTTTGGACGAAGAGTCGGTCTTTGG
TTTCTATTCGGATTAGTTGCCATCAGCACCCTATCCCTCCTCATATTCATGCACAACGACATTCCCCCGAGCAAA
ACGGTGATCACAGATAACGAAAGAGGCTTGGATGCGCCTGTGGAGAAAGACTCAGAGACGGTCGCGAAGGATGAA
AAATAG
Gene >AgabiH97|097000
ATGTCCGAAGCTGCTCACTCCGCCGCACCCTCCCATACTTCTGAGAAGACTGTAACAGATCCTCCTAAACCAAAC
GACCCGCTGGCTGCGCTCTCTTTGCGACGAAAAATTGCTCTTACAGCGTTCCTATGTCTAGCTCAATTCCTCGAC
ACTTTCGCCAACTCAGCTCTCTTTGCTGCCTTCCCTCCCATTTCATTGGAACTCGGCATCTCGAACAGCAATGCT
GTCTGGATTATAAGCGGTTATCAGCTTACTTTTGCGGCACTTCTGCTCGGTGTAAGCATACTCTCTTTATCTTTA
TCATCTGGTCCTGAACAAGTCTACAGAGCGGACGAATGAGCGATTTGTTCAATCCTAGTAAGGGTCTACTTCCAC
AACTATTCTGACGAGTATTGACTTCGTTATAGAGTATGTCTTCTTATCGGGAGCTGCATTGCTTTCGGTATTCTC
CTTGGGCACTGGATTCGCCAAAGACGAAGTTACTTTGTTTATCCTCCGCGCTTTTATGGGTGTCGGTAAGTCTCT
TTATGACAGATGTCCGAGTGACATTACTCATAACCCAATAGGAGCTGCTTTGACAGTCCCTTCCGCGCTACATCT
CATCGTTCATCTATTCCCGGACCCAATGCAACAGACAAAAGCCATTGCCCTGTTCGGAAGCTTCGGAGCTATAGG
TAACGGTATGTCGCGTCCCTTTTGCAGATTGTGTAACGCAATGATATGACGTGTCTTCGCTACAATAGTGATCGG
GCTTATTATTGGCGCTCTCATTATCCAATGGGCAACTTGGCCGTGGCTTTTCTACGTTTTTACCATAGTTGGAGC
AGTCGTATTCGTCGCTGTGGCCATTTTATCACCTTCTCCTGAGCGTGTCGTCGTTCTTAGTAACATGCAACGCTT
CAAACGTCTCGATCTTGGTGGGATCTTCCTGGTGACTGGTGAATTTGTTTGCCGTTGCCGCCTATATCATATCCA
CTGACAAAATATATTTCAGCTGGCCTCGTACTTTTCATATTCGGTGTGACAGCCGGTTCGGTGAATGGTTGGACA
AGCGCGCGATGCTTGGCTCCGCTGATCATTTCAGTGTTTCCGATCGCTGCATTCTTCTTCTGGGAAGCGCAACTT
CCCGAAGAACAAGCTGCTATGTATGTTTTCTGCGCCAAAATGCTAGTCGCGGTACTGATGTTATCCCGTAGTCCT
CCGAGTCTCTGGCGAGTGAGAAACTTCACAATCCTCGTTGTAGGATCTGCGACTGTGCATTACTGGTGGTTTGGA
GTTGTGCAGATCTTGTTCTCGTGGGTCTGGCAAAATGTTTATCACTGGTCTCCCCTCATTACCGCCCTTCATTTG
TGAGTCATTTCACTCTTATTTTTGACTATGTCTTTTGTCTTACCGTTATCAAGCCTTCCCCTCGGGGCATTTGCC
GGTCTAGTAACGGTTACGATCAGCTCTTTCCGGAAATATTTTCCGCTAAAATGGATCCTAATCTCTGCGCAAGTT
CTCGCCTTGGTTGCAACATTACTTTTGACTTTTGGTGACTCACCACAACGCTATTTCCCTTTCGTATTTCCTGGA
TTCATTCTGGGAGCGTTTGGGGTTGCGACGGCCTATCTAACAGTCAAGTATGTTACTCGTTATGGAATGTTATAA
CGTCACTCAACTCGTTTAGCATTGCTGTGTTTGCTTCTACGCCACCCGAGAAAGCTGGTGTGGTAGGCTCCATCT
TCAACTGTTTCGAACAGGTTGGAAGCGCAGCTGGAAGTGCTATAATAACTTCTATCCAGACAAGTGTTGAAGTAA
ATCATGGCGGACCTAACTCATTCTTTGGACGAAGAGTCGGTCTTTGGTTTCTATTCGGATTAGTTGCCATCAGCA
CCCTATCCCTCCTCATATTCATGCACAACGACATTCCCCCGAGCAAAACGGTGATCACAGATAACGAAAGAGGCT
TGGATGCGCCTGTGGAGAAAGACTCAGAGACGGTCGCGAAGGATGAAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail