Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|096720
Gene name
Locationscaffold_6:2178710..2181039
Strand+
Gene length (bp)2329
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 1.4E-87 38 503
PF20434 BD-FAE BD-FAE 1.9E-09 119 228
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.0E-08 134 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 21 405 1.0E-47
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 15 497 3.0E-47
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 21 405 3.0E-47
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 11 497 5.0E-47
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 60 535 5.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 21 405 1.0E-47
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 15 497 3.0E-47
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 21 405 3.0E-47
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 11 497 5.0E-47
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 60 535 5.0E-47
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 12 354 4.0E-45
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 21 405 1.0E-44
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 21 405 1.0E-44
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 60 454 5.0E-44
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 19 496 9.0E-42
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 45 496 2.0E-39
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 40 458 4.0E-39
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 48 534 1.0E-38
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 50 493 3.0E-38
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 57 531 4.0E-38
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 40 509 7.0E-38
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 45 496 1.0E-37
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 57 531 5.0E-37
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 12 496 5.0E-37
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 39 489 1.0E-36
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 53 535 1.0E-36
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 45 496 1.0E-36
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 45 496 2.0E-36
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 45 496 2.0E-36
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 8 538 2.0E-36
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 50 493 3.0E-36
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 45 539 3.0E-36
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 40 503 7.0E-36
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 39 491 1.0E-35
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 1 489 2.0E-35
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 45 358 2.0E-35
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 40 503 3.0E-35
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 40 503 7.0E-35
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 60 503 1.0E-34
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 1 489 1.0E-34
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 54 538 3.0E-34
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 40 503 3.0E-34
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 57 531 3.0E-34
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 54 538 3.0E-34
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 60 503 3.0E-34
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 25 496 4.0E-34
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 18 496 4.0E-34
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 45 496 7.0E-34
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 24 504 2.0E-33
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 45 496 5.0E-33
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 60 539 5.0E-33
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 57 371 5.0E-33
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 34 496 7.0E-33
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 45 496 8.0E-33
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 15 496 1.0E-32
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 57 358 2.0E-32
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 60 493 2.0E-32
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 19 496 3.0E-32
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 45 349 5.0E-32
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 57 358 5.0E-32
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 45 537 6.0E-32
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 24 349 7.0E-32
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 25 533 7.0E-32
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 87 505 8.0E-32
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 60 496 1.0E-31
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 54 535 1.0E-31
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 57 498 3.0E-31
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 15 351 3.0E-31
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 23 349 6.0E-31
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 16 489 8.0E-31
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 60 539 9.0E-31
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 45 496 1.0E-30
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 39 350 1.0E-30
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 87 505 1.0E-30
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 12 537 2.0E-30
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 45 486 2.0E-30
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 25 352 2.0E-30
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 40 267 3.0E-30
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 14 496 3.0E-30
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 25 352 1.0E-29
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 60 496 1.0E-29
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 12 364 1.0E-29
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 12 364 2.0E-29
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 53 531 2.0E-29
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 53 349 6.0E-29
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 60 540 6.0E-29
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 12 349 7.0E-29
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 12 364 8.0E-29
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 21 489 1.0E-28
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 33 533 3.0E-28
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 111 353 3.0E-28
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 20 489 4.0E-28
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 57 352 6.0E-28
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 38 533 1.0E-27
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 1 349 1.0E-27
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 45 496 2.0E-27
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 57 352 2.0E-27
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 28 349 4.0E-27
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 60 496 6.0E-27
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 38 533 6.0E-27
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 15 364 6.0E-27
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 23 506 9.0E-27
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 46 402 1.0E-26
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 15 364 1.0E-26
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 60 501 1.0E-26
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 37 500 2.0E-26
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 20 500 3.0E-26
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 45 250 5.0E-26
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 23 502 6.0E-26
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 60 479 1.0E-25
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 26 364 3.0E-25
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 50 327 5.0E-25
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 38 327 5.0E-25
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 121 448 7.0E-25
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 60 479 9.0E-25
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 20 459 2.0E-24
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 60 479 3.0E-24
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 40 357 3.0E-24
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 40 357 4.0E-24
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 40 357 6.0E-24
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 34 289 9.0E-24
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 112 352 2.0E-23
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 39 351 3.0E-23
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 34 289 3.0E-23
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 34 289 3.0E-23
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 102 232 4.0E-22
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 133 353 5.0E-22
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 2 350 2.0E-20
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 21 501 3.0E-20
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 60 244 4.0E-20
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 101 232 5.0E-20
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 102 232 6.0E-20
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 38 350 7.0E-20
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 102 232 1.0E-19
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 38 350 2.0E-19
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 16 357 1.0E-18
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 17 206 1.0E-15
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 45 225 2.0E-15
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 60 256 3.0E-15
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 62 504 7.0E-15
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 10 350 1.0E-14
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 57 348 3.0E-12
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 60 175 5.0E-10
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 60 175 5.0E-10
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 60 175 5.0E-10
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 118 269 3.0E-07
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 118 269 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|096720
MCLVSQSKDGVMVAMFTGSLISFALISSTLAAPQARGPTVKLDYGTFHGLEDSSTGIVYYRGVRFADPPIGNLRW
RAPVSPPSFHLGDVDATEFADACIDAGQTAVNPGTSEDCLFGNVYVPINTTTSDALPVMVWFHGGGFQSGNSRAP
PEMMMQSSANPMIFVSFAYRLGPLGFLGGNQIHDNGDLNAGFLDQRAALRWLQRYISQFGGDKEKVTIWGESAGA
GSTMFHLIANGGDNENLFQAAMGDSPSLSFVPVFDEDYDVTLFDDYVGFAGCGNQGNDVVDCLRTAEIDTLAVAS
NRLLASRTSTLFLFAPIVDRSIINERPVEAFKAGHFAHVPVLFGSNTNEGAFWSAGLPDPSANTSMPNATEETVF
NFIRGQYTTLTQASLDPGFELYPLDSFNGSFSLQGQQMYGEARYICTASLIAGSASRFSTSFQYHYDNPHLGSFH
ADDLQAFFNPPSNADENDLALFEAMREYFTSFVTTGIPSANNEVAWEPASSSAGSPRMLFHPGSVAMEDISDELD
TRCNFWHEISGELQT*
Coding >AgabiH97|096720
ATGTGTCTAGTCAGCCAGTCAAAGGACGGCGTTATGGTTGCAATGTTTACCGGATCTCTCATCTCTTTCGCTCTA
ATATCTTCAACACTGGCGGCTCCTCAAGCTCGAGGGCCGACCGTTAAACTCGACTATGGTACATTCCACGGTCTG
GAGGATTCATCGACAGGAATTGTCTATTATCGCGGTGTACGATTTGCTGACCCTCCCATTGGAAATCTTCGGTGG
AGAGCCCCAGTATCACCTCCGTCATTTCATTTAGGTGACGTCGACGCTACCGAGTTTGCTGATGCTTGCATTGAT
GCTGGCCAGACTGCTGTCAATCCAGGTACATCGGAGGACTGTCTCTTCGGTAACGTATACGTTCCAATCAATACG
ACCACCAGCGACGCACTTCCAGTCATGGTCTGGTTTCATGGTGGCGGGTTTCAATCTGGGAATAGCCGAGCACCA
CCCGAAATGATGATGCAATCGAGCGCAAATCCGATGATTTTCGTTTCATTCGCGTATCGACTTGGGCCACTTGGT
TTCCTCGGTGGGAATCAAATCCACGATAACGGGGATCTTAACGCTGGGTTCTTAGATCAACGCGCGGCCCTTCGT
TGGTTACAACGTTACATATCTCAATTTGGTGGAGACAAAGAGAAAGTGACTATATGGGGAGAATCTGCTGGAGCT
GGCTCAACTATGTTTCACCTTATTGCCAATGGAGGCGATAATGAAAACTTGTTTCAAGCAGCAATGGGAGATAGT
CCGTCATTGAGCTTTGTACCCGTCTTTGATGAGGACTATGATGTTACGCTGTTTGACGATTACGTGGGTTTTGCA
GGTTGTGGAAATCAAGGAAACGATGTAGTGGACTGTCTTCGTACAGCTGAAATCGATACTCTCGCCGTAGCCAGT
AATCGTCTTTTGGCTTCGCGAACATCGACGCTTTTCCTCTTTGCTCCTATCGTAGATAGAAGTATTATCAACGAG
CGTCCAGTCGAGGCATTCAAAGCTGGACATTTTGCTCATGTCCCAGTTTTGTTTGGGTCGAATACTAACGAAGGA
GCATTCTGGTCTGCGGGTCTCCCAGACCCGTCTGCTAACACTTCGATGCCAAACGCTACAGAAGAGACTGTTTTC
AACTTCATTCGTGGCCAATATACAACCTTGACTCAAGCTTCCCTCGATCCGGGTTTCGAATTGTATCCCTTGGAT
TCTTTCAATGGGTCGTTTAGTCTTCAGGGTCAACAGATGTATGGGGAAGCGAGATACATTTGTACAGCGTCATTG
ATTGCTGGAAGTGCATCACGCTTTAGCACCTCGTTCCAGTATCATTATGACAACCCTCACCTAGGATCTTTCCAC
GCAGATGATTTACAAGCATTCTTTAACCCCCCTTCTAACGCGGACGAAAACGATTTAGCTTTATTTGAGGCCATG
AGGGAATACTTTACATCTTTCGTCACGACAGGAATCCCTTCAGCTAATAATGAAGTGGCATGGGAGCCTGCTAGC
TCGTCTGCTGGAAGTCCGCGGATGTTATTCCATCCTGGGAGTGTGGCCATGGAAGACATAAGTGACGAGCTGGAT
ACCCGCTGCAACTTTTGGCATGAAATTTCTGGAGAACTACAAACCTGA
Transcript >AgabiH97|096720
ATGTGTCTAGTCAGCCAGTCAAAGGACGGCGTTATGGTTGCAATGTTTACCGGATCTCTCATCTCTTTCGCTCTA
ATATCTTCAACACTGGCGGCTCCTCAAGCTCGAGGGCCGACCGTTAAACTCGACTATGGTACATTCCACGGTCTG
GAGGATTCATCGACAGGAATTGTCTATTATCGCGGTGTACGATTTGCTGACCCTCCCATTGGAAATCTTCGGTGG
AGAGCCCCAGTATCACCTCCGTCATTTCATTTAGGTGACGTCGACGCTACCGAGTTTGCTGATGCTTGCATTGAT
GCTGGCCAGACTGCTGTCAATCCAGGTACATCGGAGGACTGTCTCTTCGGTAACGTATACGTTCCAATCAATACG
ACCACCAGCGACGCACTTCCAGTCATGGTCTGGTTTCATGGTGGCGGGTTTCAATCTGGGAATAGCCGAGCACCA
CCCGAAATGATGATGCAATCGAGCGCAAATCCGATGATTTTCGTTTCATTCGCGTATCGACTTGGGCCACTTGGT
TTCCTCGGTGGGAATCAAATCCACGATAACGGGGATCTTAACGCTGGGTTCTTAGATCAACGCGCGGCCCTTCGT
TGGTTACAACGTTACATATCTCAATTTGGTGGAGACAAAGAGAAAGTGACTATATGGGGAGAATCTGCTGGAGCT
GGCTCAACTATGTTTCACCTTATTGCCAATGGAGGCGATAATGAAAACTTGTTTCAAGCAGCAATGGGAGATAGT
CCGTCATTGAGCTTTGTACCCGTCTTTGATGAGGACTATGATGTTACGCTGTTTGACGATTACGTGGGTTTTGCA
GGTTGTGGAAATCAAGGAAACGATGTAGTGGACTGTCTTCGTACAGCTGAAATCGATACTCTCGCCGTAGCCAGT
AATCGTCTTTTGGCTTCGCGAACATCGACGCTTTTCCTCTTTGCTCCTATCGTAGATAGAAGTATTATCAACGAG
CGTCCAGTCGAGGCATTCAAAGCTGGACATTTTGCTCATGTCCCAGTTTTGTTTGGGTCGAATACTAACGAAGGA
GCATTCTGGTCTGCGGGTCTCCCAGACCCGTCTGCTAACACTTCGATGCCAAACGCTACAGAAGAGACTGTTTTC
AACTTCATTCGTGGCCAATATACAACCTTGACTCAAGCTTCCCTCGATCCGGGTTTCGAATTGTATCCCTTGGAT
TCTTTCAATGGGTCGTTTAGTCTTCAGGGTCAACAGATGTATGGGGAAGCGAGATACATTTGTACAGCGTCATTG
ATTGCTGGAAGTGCATCACGCTTTAGCACCTCGTTCCAGTATCATTATGACAACCCTCACCTAGGATCTTTCCAC
GCAGATGATTTACAAGCATTCTTTAACCCCCCTTCTAACGCGGACGAAAACGATTTAGCTTTATTTGAGGCCATG
AGGGAATACTTTACATCTTTCGTCACGACAGGAATCCCTTCAGCTAATAATGAAGTGGCATGGGAGCCTGCTAGC
TCGTCTGCTGGAAGTCCGCGGATGTTATTCCATCCTGGGAGTGTGGCCATGGAAGACATAAGTGACGAGCTGGAT
ACCCGCTGCAACTTTTGGCATGAAATTTCTGGAGAACTACAAACCTGA
Gene >AgabiH97|096720
ATGTGTCTAGTCAGGTAATTCTAAAATATCCTCTGTGTGAGTCGTCAACTGACGGACCGTAACATAATATATAAG
CCAGTCAAAGGACGGCGTTATGGTTGCAATGTTTACCGGATCTCTCATCTCTTTCGCTCTAATATCTTCAACACT
GGCGGCTCCTCAAGCTCGAGGGCCGACCGTTAAACTCGACTGTAACTTGTTACCTAAACTTCGTCTGCGAGTCGA
GGCTTACCATGTTCCCAATAGATGGTACATTCCACGGTCTGGAGGATTCATCGACAGGAATTGTCTATTATCGCG
GTGTACGATTTGCTGACCCTCCCATTGGAAATCTTCGGTGGAGAGCCCCAGTATCACCTCCGTCATTTCATTTAG
GTGACGTCGACGCTACCGAGGTTAATATATCTCTAAATTTCGTGTTCTATATACTGACTCCACGTTTAGTTTGCT
GATGCTTGCATTGATGCTGGCCAGACTGCTGTCAATCCAGGTACATCGGAGGACTGTCTCTTCGGTAACGTTCGT
GTATCACGATCCTCAAATGATATCCTATTGACGGGTTTCCGTACCTAGGTATACGTTCCAATCAATACGACCACC
AGCGACGCACTTCCAGTCATGGTCTGGTTTCATGGTGAGATCCTTGCTTGCCATCGGTGTTCTCATATTTCTCAC
CTGGCCCTGAAATAGGTGGCGGGTTTCAATCTGGGAATAGCCGAGCACCACCCGAAATGATGATGCAATCGAGCG
CAAATCCGATGATTTTCGTTTCATTCGCGTATCGACTTGGGCCACTTGGTTTCCTCGGTAGGTCTTGAACCCTAA
TCGATTATGAAAGTTATACCAAATGGTTATCTATAGGTGGGAATCAAATCCACGATAACGGGGATCTTAACGCTG
GGTTCTTAGATCAAGTGATCAAGTTTACCTTATAGGCCTGAGATAGTATGCTTACAGATATCCTAGCGCGCGGCC
CTTCGTTGGTTACAACGTTACATATCTCAATTTGGTGGAGACAAAGAGTAAGTTTGTACTGACATGTTTTGGCAT
ACTGCTGACAGAAATACGTTAGGAAAGTGACTATATGGGGAGAATCTGCTGGAGCTGGCTCAACTATGTTTCACG
TAAGATAATCAATCATCATCTTAAACTGAACGTTCACTTACGGATAAAACAGCTTATTGCCAATGGAGGCGATAA
TGAAAACTTGTTTCAAGCAGCAATGGGAGATAGTCCGTCATTGAGCTTTGTACCCGTCTTTGATGAGGACTATGA
TGTTACGCTGTTTGACGATTACGTGGGTTTTGCGTAAGTAAAGCTAGCTCTGCAGGCAAACATCGTACTAATGGA
GTCTGTAAACAGAGGTTGTGGAAATCAAGGAAACGATGTAGTGGACTGTCTTCGTACAGCTGAAATCGATACTCT
CGCCGTAGCCAGTAATCGTCTTTTGGCTTCGCGAACATCGACGCTTTTCCTCTTTGCTCCTATCGTAGATAGAAG
TATTATCAACGAGCGTCCAGTCGAGGCATTCAAAGCTGGACATTTTGCTCATGTCCCAGTTTTGTTTGGGTCGGT
TCCTTTTCCCCAACTCTTGAAATAACACAAAGTTGATCTGTGACTCTCAGGTCGAATACTAACGAAGGAGCATTC
TGGTCTGCGGGTCTCCCAGACCCGTCTGCTAACACTTCGATGCCAAACGCTACAGAAGAGACTGTTTTCAACTTC
ATTCGTGGCCAATATACAACCTTGACTCAAGCTTCCCTCGATCCGGGTTTCGAATTGTATCCCTTGGATTCTTTC
AATGGGTCGTTTAGTCTTCAGGGTCAACAGATGTATGGGGAAGCGAGATACATTTGTACAGCGTCATTGATTGCT
GGAAGTGCATCACGCTTTAGCACCTCGTTCCAGTATCAGTGAGTTGAAAGCCTATGCTCATTGTACTACAACTCA
TGATATCCAGTTATGACAACCCTCACCTAGGATCTTTCCACGCAGATGATTTACAAGCATTCTTTAACCCCCCTT
CTAACGCGGACGAAAACGATTTAGCTTTATTTGAGGCCATGAGGGAATACTTTACATCTTTCGTCACGACAGGAA
TCCCTTCAGCTAATAATGAAGTGGCATGGGAGGTGCGTTAGATTAACGTAGTATTTCAAGCAATATCTTGACTGT
TTTTTTTTTTCATCTATGTTAGCCTGCTAGCTCGTCTGCTGGAAGTCCGCGGATGTTATTCCATCCTGGGAGTGT
GGCCATGGAAGACATAAGTGACGAGCTGGATACCCGCTGCAACTTTTGGCATGAAATTTCTGGAGAACTACAAAC
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail