Fungal Genomics

Agaricus bisporus var bisporus H39 Agaricus bisporus var bisporus H97 Agaricus bisporus var burnettii H119p4 Aspergillus niger CBS 112.32 Aspergillus niger CBS 113.50 Aspergillus niger CBS 115988 Aspergillus niger CBS 115989 Aspergillus niger CBS 118.52 Aspergillus niger CBS 124.48 Aspergillus niger CBS 131.52 Aspergillus niger CBS 133816 Aspergillus niger CBS 147320 Aspergillus niger CBS 147321 Aspergillus niger CBS 147322 Aspergillus niger CBS 147323 Aspergillus niger CBS 147324 Aspergillus niger CBS 147343 Aspergillus niger CBS 147344 Aspergillus niger CBS 147345 Aspergillus niger CBS 147346 Aspergillus niger CBS 147347 Aspergillus niger CBS 147352 Aspergillus niger CBS 147353 Aspergillus niger CBS 147371 Aspergillus niger CBS 147482 Aspergillus niger CBS 630.78 Aspergillus niger CBS 769.97 Niveomyces coronatus CBS 149186 Ophiocordyceps australis 1348a (Ghana) Ophiocordyceps australis map64 (Brazil) Ophiocordyceps camponoti-floridani Ophiocordyceps camponoti-rufipedis Ophiocordyceps kimflemingae Ophiocordyceps subramaniannii Penicillium roqueforti DTO002I6 Penicillium roqueforti DTO003C3 Penicillium roqueforti DTO003H1 (CBS 147308) Penicillium roqueforti DTO006G1 Penicillium roqueforti DTO006G7 Penicillium roqueforti DTO012A1 Penicillium roqueforti DTO012A2 (CBS 147309) Penicillium roqueforti DTO012A6 (CBS 147310) Penicillium roqueforti DTO012A7 Penicillium roqueforti DTO012A8 Penicillium roqueforti DTO012A9 Penicillium roqueforti DTO013E5 Penicillium roqueforti DTO013F2 Penicillium roqueforti DTO013F5 (CBS 147311) Penicillium roqueforti DTO027I6 Penicillium roqueforti DTO032C6 Penicillium roqueforti DTO039G3 Penicillium roqueforti DTO046C5 Penicillium roqueforti DTO070G2 (CBS 147317) Penicillium roqueforti DTO081F9 (CBS 147318) Penicillium roqueforti DTO101D6 (CBS 147325) Penicillium roqueforti DTO102I9 (CBS 147326) Penicillium roqueforti DTO126G2 (CBS 147330) Penicillium roqueforti DTO127F7 (CBS 147331) Penicillium roqueforti DTO127F9 (CBS 147332) Penicillium roqueforti DTO130C1 (CBS 147333) Penicillium roqueforti DTO163C3 (CBS 147337) Penicillium roqueforti DTO163F5 (CBS 147338) Penicillium roqueforti DTO163G4 (CBS 147339) Penicillium roqueforti DTO265D5 (CBS 147372) Penicillium roqueforti DTO369A1 (CBS 147354) Penicillium roqueforti DTO375B1 (CBS 147355) Penicillium roqueforti DTO377G2 (LCP 96.3914a) Penicillium roqueforti LCP96 04111 Rhodonia placenta FPRL280 Torrubiellomyces zombiae CBS 149187

General Properties

Protein ID	AgabiH97|096710
Gene name
Location	scaffold_6:2177227..2178072
Strand	+
Gene length (bp)	845
Transcript length (bp)	666
Coding sequence length (bp)	666
Protein length (aa)	222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF13489	Methyltransf_23	Methyltransferase domain	7.5E-09	42	207

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 29	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label	Description	Expression (RPKM)	Confidence interval (low)	Confidence interval (high)
Casing	Casing mycelium	0.07	0.0	0.25
Initials	Initials knots	0.40	0.0	0.90
Pileal_Stipeal_center	Stage I stipe center	0.75	0.0	1.52
Pileal_Stipeal_shell	Stage I stipe shell	0.61	0.0	1.35
DIF_stipe_center	Stage II stipe center	0.87	0.0	1.75
DIF_stipe_shell	Stage II stipe shell	0.28	0.0	0.70
DIF_stipe_skin	Stage II stipe skin	0.12	0.0	0.39
DIF_cap_skin	Stage II cap skin	0.26	0.0	0.65
DIF_cap_tissue	Stage II cap tissue	0.77	0.0	1.55
DIF_gill_tissue	Stage II gill tissue	0.48	0.0	1.05
YFB_stipe_center	Young fruiting body stipe center	0.72	0.0	1.45
YFB_stipe_shell	Young fruiting body stipe shell	0.19	0.0	0.51
YFB_stipe_skin	Young fruiting body stipe skin	0.36	0.0	0.83
YFB_cap_skin	Young fruiting body cap skin	0.17	0.0	0.49
YFB_cap_tissue	Young fruiting body cap tissue	0.28	0.0	0.70
YFB_gill_tissue	Young fruiting body gill tissue	0.47	0.0	1.04
YFB_veil	Young fruiting body veil	0.53	0.0	1.16

Differential expression

Label1	Label2	Q-value	Significant difference
Casing	DIF_gill_tissue	0.404055	no
Casing	YFB_stipe_center	0.392892	no
Casing	YFB_stipe_shell	1.000000	no
Casing	YFB_stipe_skin	0.450181	no
Casing	YFB_cap_skin	1.000000	no
Casing	YFB_cap_tissue	1.000000	no
Casing	YFB_gill_tissue	0.407067	no
Casing	YFB_veil	0.398445	no
Casing	Initials	0.420780	no
Casing	Pileal_Stipeal_center	0.392973	no
Casing	Pileal_Stipeal_shell	0.397144	no
Casing	DIF_stipe_center	0.392355	no
Casing	DIF_stipe_shell	1.000000	no
Casing	DIF_stipe_skin	1.000000	no
Casing	DIF_cap_skin	1.000000	no
Casing	DIF_cap_tissue	0.392818	no
DIF_gill_tissue	YFB_stipe_center	0.748179	no
DIF_gill_tissue	YFB_stipe_shell	0.507005	no
DIF_gill_tissue	YFB_stipe_skin	0.840047	no
DIF_gill_tissue	YFB_cap_skin	0.450318	no
DIF_gill_tissue	YFB_cap_tissue	0.681663	no
DIF_gill_tissue	YFB_gill_tissue	0.977900	no
DIF_gill_tissue	YFB_veil	0.950733	no
YFB_stipe_center	YFB_stipe_shell	0.271748	no
YFB_stipe_center	YFB_stipe_skin	0.542910	no
YFB_stipe_center	YFB_cap_skin	0.247801	no
YFB_stipe_center	YFB_cap_tissue	0.356368	no
YFB_stipe_center	YFB_gill_tissue	0.721057	no
YFB_stipe_center	YFB_veil	0.816391	no
YFB_stipe_shell	YFB_stipe_skin	0.695563	no
YFB_stipe_shell	YFB_cap_skin	1.000000	no
YFB_stipe_shell	YFB_cap_tissue	1.000000	no
YFB_stipe_shell	YFB_gill_tissue	0.523257	no
YFB_stipe_shell	YFB_veil	0.443780	no
YFB_stipe_skin	YFB_cap_skin	0.607484	no
YFB_stipe_skin	YFB_cap_tissue	0.884303	no
YFB_stipe_skin	YFB_gill_tissue	0.863510	no
YFB_stipe_skin	YFB_veil	0.783987	no
YFB_cap_skin	YFB_cap_tissue	1.000000	no
YFB_cap_skin	YFB_gill_tissue	0.470451	no
YFB_cap_skin	YFB_veil	0.374960	no
YFB_cap_tissue	YFB_gill_tissue	0.695870	no
YFB_cap_tissue	YFB_veil	0.605386	no
YFB_gill_tissue	YFB_veil	0.937397	no
Initials	DIF_gill_tissue	0.906742	no
Initials	YFB_stipe_center	0.596653	no
Initials	YFB_stipe_shell	0.595211	no
Initials	YFB_stipe_skin	0.958744	no
Initials	YFB_cap_skin	0.563533	no
Initials	YFB_cap_tissue	0.819478	no
Initials	YFB_gill_tissue	0.921810	no
Initials	YFB_veil	0.836647	no
Initials	Pileal_Stipeal_center	0.549091	no
Initials	Pileal_Stipeal_shell	0.755190	no
Initials	DIF_stipe_center	0.417847	no
Initials	DIF_stipe_shell	0.820582	no
Initials	DIF_stipe_skin	0.442542	no
Initials	DIF_cap_skin	0.781457	no
Initials	DIF_cap_tissue	0.540745	no
Pileal_Stipeal_center	DIF_gill_tissue	0.709559	no
Pileal_Stipeal_center	YFB_stipe_center	0.974975	no
Pileal_Stipeal_center	YFB_stipe_shell	0.267670	no
Pileal_Stipeal_center	YFB_stipe_skin	0.489912	no
Pileal_Stipeal_center	YFB_cap_skin	0.246828	no
Pileal_Stipeal_center	YFB_cap_tissue	0.325421	no
Pileal_Stipeal_center	YFB_gill_tissue	0.689007	no
Pileal_Stipeal_center	YFB_veil	0.783243	no
Pileal_Stipeal_center	Pileal_Stipeal_shell	0.884007	no
Pileal_Stipeal_center	DIF_stipe_center	0.908196	no
Pileal_Stipeal_center	DIF_stipe_shell	0.344928	no
Pileal_Stipeal_center	DIF_stipe_skin	0.275437	no
Pileal_Stipeal_center	DIF_cap_skin	0.348230	no
Pileal_Stipeal_center	DIF_cap_tissue	0.984848	no
Pileal_Stipeal_shell	DIF_gill_tissue	0.881906	no
Pileal_Stipeal_shell	YFB_stipe_center	0.914572	no
Pileal_Stipeal_shell	YFB_stipe_shell	0.370665	no
Pileal_Stipeal_shell	YFB_stipe_skin	0.697569	no
Pileal_Stipeal_shell	YFB_cap_skin	0.339037	no
Pileal_Stipeal_shell	YFB_cap_tissue	0.533104	no
Pileal_Stipeal_shell	YFB_gill_tissue	0.867943	no
Pileal_Stipeal_shell	YFB_veil	0.937059	no
Pileal_Stipeal_shell	DIF_stipe_center	0.769092	no
Pileal_Stipeal_shell	DIF_stipe_shell	0.533516	no
Pileal_Stipeal_shell	DIF_stipe_skin	0.315510	no
Pileal_Stipeal_shell	DIF_cap_skin	0.522346	no
Pileal_Stipeal_shell	DIF_cap_tissue	0.872121	no
DIF_stipe_center	DIF_gill_tissue	0.558909	no
DIF_stipe_center	YFB_stipe_center	0.870152	no
DIF_stipe_center	YFB_stipe_shell	0.202921	no
DIF_stipe_center	YFB_stipe_skin	0.359432	no
DIF_stipe_center	YFB_cap_skin	0.192167	no
DIF_stipe_center	YFB_cap_tissue	0.236900	no
DIF_stipe_center	YFB_gill_tissue	0.538952	no
DIF_stipe_center	YFB_veil	0.636999	no
DIF_stipe_center	DIF_stipe_shell	0.239320	no
DIF_stipe_center	DIF_stipe_skin	0.263203	no
DIF_stipe_center	DIF_cap_skin	0.271064	no
DIF_stipe_center	DIF_cap_tissue	0.921575	no
DIF_stipe_shell	DIF_gill_tissue	0.689117	no
DIF_stipe_shell	YFB_stipe_center	0.364167	no
DIF_stipe_shell	YFB_stipe_shell	1.000000	no
DIF_stipe_shell	YFB_stipe_skin	0.886043	no
DIF_stipe_shell	YFB_cap_skin	1.000000	no
DIF_stipe_shell	YFB_cap_tissue	1.000000	no
DIF_stipe_shell	YFB_gill_tissue	0.720894	no
DIF_stipe_shell	YFB_veil	0.608546	no
DIF_stipe_shell	DIF_stipe_skin	1.000000	no
DIF_stipe_shell	DIF_cap_skin	1.000000	no
DIF_stipe_shell	DIF_cap_tissue	0.325777	no
DIF_stipe_skin	DIF_gill_tissue	0.351824	no
DIF_stipe_skin	YFB_stipe_center	0.268374	no
DIF_stipe_skin	YFB_stipe_shell	1.000000	no
DIF_stipe_skin	YFB_stipe_skin	0.462059	no
DIF_stipe_skin	YFB_cap_skin	1.000000	no
DIF_stipe_skin	YFB_cap_tissue	1.000000	no
DIF_stipe_skin	YFB_gill_tissue	0.408913	no
DIF_stipe_skin	YFB_veil	0.338227	no
DIF_stipe_skin	DIF_cap_skin	1.000000	no
DIF_stipe_skin	DIF_cap_tissue	0.267967	no
DIF_cap_skin	DIF_gill_tissue	0.665887	no
DIF_cap_skin	YFB_stipe_center	0.370264	no
DIF_cap_skin	YFB_stipe_shell	1.000000	no
DIF_cap_skin	YFB_stipe_skin	0.857794	no
DIF_cap_skin	YFB_cap_skin	1.000000	no
DIF_cap_skin	YFB_cap_tissue	1.000000	no
DIF_cap_skin	YFB_gill_tissue	0.685431	no
DIF_cap_skin	YFB_veil	0.564413	no
DIF_cap_skin	DIF_cap_tissue	0.342199	no
DIF_cap_tissue	DIF_gill_tissue	0.689083	no
DIF_cap_tissue	YFB_stipe_center	0.962272	no
DIF_cap_tissue	YFB_stipe_shell	0.265355	no
DIF_cap_tissue	YFB_stipe_skin	0.479204	no
DIF_cap_tissue	YFB_cap_skin	0.242550	no
DIF_cap_tissue	YFB_cap_tissue	0.323787	no
DIF_cap_tissue	YFB_gill_tissue	0.669413	no
DIF_cap_tissue	YFB_veil	0.771178	no

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>AgabiH97|096710 MTSTIANAPIQHQKSLPEATYLLPTTESERVRFDTQHQSITRAFGDKLVLSPVILTKGDKVLDSGAGSCSWLLHF ATTLTLDIELYASDIETRFFPINPPKNVKLWEASSVDLPKDWSNAFQLVHQRLLISAFTSNDWPLAISELFRVTK PGGWVELCEAGAEIDCPSHPNHRALTAARIAYEASDHVIQAAMLLPQWLKDAGFVKIQSVEGKYPIGKRLF*
Coding	>AgabiH97|096710 ATGACATCGACCATCGCCAACGCACCGATACAACACCAGAAGTCATTGCCTGAAGCAACGTACCTCCTTCCCACA ACTGAGTCGGAGCGCGTCAGGTTTGATACCCAGCATCAGAGCATAACGCGTGCTTTCGGTGACAAACTTGTCCTA TCTCCAGTGATCCTCACAAAAGGCGACAAAGTGCTCGACTCCGGGGCAGGATCCTGCAGCTGGCTTCTTCATTTT GCGACGACCTTGACGCTAGACATCGAACTTTACGCTTCGGATATCGAGACTCGATTCTTTCCCATCAATCCTCCA AAGAACGTCAAACTATGGGAGGCATCCTCAGTGGACCTTCCTAAAGATTGGTCTAATGCATTCCAATTGGTCCAT CAACGACTTCTCATTAGTGCGTTCACATCAAATGATTGGCCTTTAGCAATAAGCGAGCTCTTTCGCGTCACAAAG CCTGGCGGCTGGGTAGAACTCTGTGAAGCAGGTGCAGAAATTGATTGTCCCTCGCATCCAAACCACAGGGCGCTC ACAGCTGCGCGAATCGCATACGAAGCAAGTGACCACGTTATTCAAGCCGCCATGTTGTTGCCTCAATGGTTGAAA GACGCTGGTTTCGTTAAAATCCAATCCGTGGAGGGAAAGTACCCCATAGGAAAGCGCCTATTTTGA
Transcript	>AgabiH97|096710 ATGACATCGACCATCGCCAACGCACCGATACAACACCAGAAGTCATTGCCTGAAGCAACGTACCTCCTTCCCACA ACTGAGTCGGAGCGCGTCAGGTTTGATACCCAGCATCAGAGCATAACGCGTGCTTTCGGTGACAAACTTGTCCTA TCTCCAGTGATCCTCACAAAAGGCGACAAAGTGCTCGACTCCGGGGCAGGATCCTGCAGCTGGCTTCTTCATTTT GCGACGACCTTGACGCTAGACATCGAACTTTACGCTTCGGATATCGAGACTCGATTCTTTCCCATCAATCCTCCA AAGAACGTCAAACTATGGGAGGCATCCTCAGTGGACCTTCCTAAAGATTGGTCTAATGCATTCCAATTGGTCCAT CAACGACTTCTCATTAGTGCGTTCACATCAAATGATTGGCCTTTAGCAATAAGCGAGCTCTTTCGCGTCACAAAG CCTGGCGGCTGGGTAGAACTCTGTGAAGCAGGTGCAGAAATTGATTGTCCCTCGCATCCAAACCACAGGGCGCTC ACAGCTGCGCGAATCGCATACGAAGCAAGTGACCACGTTATTCAAGCCGCCATGTTGTTGCCTCAATGGTTGAAA GACGCTGGTTTCGTTAAAATCCAATCCGTGGAGGGAAAGTACCCCATAGGAAAGCGCCTATTTTGA
Gene	>AgabiH97|096710 ATGACATCGACCATCGCCAACGCACCGATACAACACCAGAAGTCATTGCCTGAAGCAACGTACCTCCTTCCCACA ACTGAGTCGGAGCGCGTCAGGTGGGTGGTGAGACATATAGCTCAGCAGCCTGTGCTGAAAATCCTCCACTGCGCC GGTAGGTTTGATACCCAGCATCAGAGCATAACGCGTGCTTTCGGTGACAAACTTGTCCTATCTCCAGTGATCCTC ACAAAAGGCGACAAAGTGCTCGACTCCGGGGCAGGATCCTGTATGTGTGACAACCATTCAAACCGACCTATCTTT TTGACCAATTCGCGATGCAGGCAGCTGGCTTCTTCATTTTGCGACGACCTTGACGCTAGACATCGAACTTTACGC TTCGGATATCGAGACTCGATTCTTTCCCATCAATCCTCCAAAGAACGTCAAACTATGGGAGGCATCCTCAGTGGA CCTTCCTAAAGATTGGTCTAATGCATTCCAATTGGTCCATCAACGACTTCTCATTAGTGCGTTCACATCAAATGA TTGGCCTTTAGCAATAAGCGAGCTCTTTCGCGTCACAAAGCCTGGCGGCTGGGTAGAACTCTGTGAAGCAGGTGC AGAAATTGATTGTCCCTCGCATCCAAACCACAGGGCGCTCACAGCTGCGCGAATCGCATACGAAGCAAGTGACCA CGTTATTCAAGCCGCCATGTTGTTGCCTCAATGGTTGAAAGACGCTGGTTTCGTTAAAATCCAATCCGTGGAGGG AAAGTACCCCATAGGAAAGTGGGCCGGATCTGACGGAGAACATGCTCGTCATGGACTAATTGGATTTTTGAGGGC CCTCAAGGCGCCTATTTTGA