Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|096660
Gene name
Locationscaffold_6:2145469..2149774
Strand-
Gene length (bp)4305
Transcript length (bp)4305
Coding sequence length (bp)4305
Protein length (aa) 1435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.3E-63 926 1163
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.9E-15 112 245
PF13976 gag_pre-integrs GAG-pre-integrase domain 8.3E-13 475 534
PF00665 rve Integrase core domain 5.3E-12 550 648
PF00098 zf-CCHC Zinc knuckle 2.7E-04 295 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 108 1409 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 182 1417 1.0E-165
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1081 1320 1.0E-32
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1002 1317 3.0E-32
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 902 1400 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 108 1409 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 182 1417 1.0E-165
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1081 1320 1.0E-32
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1002 1317 3.0E-32
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 902 1400 3.0E-31
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 902 1400 3.0E-31
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 894 1400 5.0E-31
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 894 1400 7.0E-31
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 902 1400 7.0E-31
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 902 1400 8.0E-31
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 894 1400 2.0E-30
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 894 1400 3.0E-30
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 894 1400 3.0E-30
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 894 1400 3.0E-30
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 894 1400 3.0E-30
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 894 1400 3.0E-30
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 902 1400 3.0E-30
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 902 1400 3.0E-30
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 902 1400 3.0E-30
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 902 1400 3.0E-30
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 902 1400 4.0E-30
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 894 1400 4.0E-30
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 902 1400 4.0E-30
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 902 1400 7.0E-30
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 902 1400 7.0E-30
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 902 1400 8.0E-30
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 902 1400 1.0E-29
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 894 1400 1.0E-29
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 902 1400 2.0E-29
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 902 1400 3.0E-29
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 902 1400 4.0E-29
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 902 1400 4.0E-29
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 902 1400 5.0E-29
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 894 1400 5.0E-29
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 902 1400 5.0E-29
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 902 1400 6.0E-29
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 902 1400 7.0E-29
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 902 1400 1.0E-28
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 902 1400 1.0E-28
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 902 1400 1.0E-28
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 902 1400 2.0E-28
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 902 1400 2.0E-28
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 902 1400 5.0E-28
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 902 1400 5.0E-28
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 902 1400 7.0E-27
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 902 1400 1.0E-26
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 902 1400 2.0E-26
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 894 1407 9.0E-24
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 894 1407 2.0E-23
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 902 1248 2.0E-20
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 894 1132 5.0E-19
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 491 739 1.0E-14
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 491 739 1.0E-14
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 491 739 2.0E-14
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 346 701 6.0E-13
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 346 691 7.0E-13
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 346 691 8.0E-13
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 346 691 8.0E-13
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 346 691 8.0E-13
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 346 691 8.0E-13
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 346 691 8.0E-13
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 346 691 8.0E-13
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 346 691 8.0E-13
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 346 691 9.0E-13
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 346 691 9.0E-13
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 346 691 1.0E-12
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 346 691 1.0E-12
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 346 691 2.0E-12
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 346 691 2.0E-12
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 346 691 2.0E-12
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 346 691 2.0E-12
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 346 691 2.0E-12
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 346 691 2.0E-12
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 346 691 2.0E-12
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 346 691 2.0E-12
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 346 691 2.0E-12
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 346 691 2.0E-12
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 346 691 2.0E-12
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 346 691 2.0E-12
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 346 691 2.0E-12
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 346 691 2.0E-12
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 346 691 2.0E-12
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 346 691 2.0E-12
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 346 691 2.0E-12
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 346 691 2.0E-12
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 346 691 2.0E-12
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 346 691 2.0E-12
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 346 691 2.0E-12
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 346 691 3.0E-12
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 346 691 3.0E-12
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 346 691 3.0E-12
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 346 691 4.0E-12
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 346 691 5.0E-12
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 346 721 5.0E-12
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 346 721 6.0E-12
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 346 691 6.0E-12
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 346 691 9.0E-12
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 346 691 2.0E-11
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 905 997 5.0E-10
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1201 1280 4.0E-07
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 499 691 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0015074 DNA integration Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0006259 DNA metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|096660
MQRQVMGPGLGENTSETLQFPKFNGTNYHVWSDNVKSALQAKSVWGITSRREKCPPKPPDEYPGHYIAITVTDED
GKSTSTRTRKEGQALVDAMESKGYQVWEQGVEKYERWLNRDDMAMGLIRNSIEYTQRESVIDCQTSAEMWDHLHE
VYVDQQSGINIHFYYQELYAKKWDGHSSMSDHIGFYLNIRRRIIETGNHIDDHAIISAILLSLPSTPTWEVVKQN
LLYKEDRLTLDIVSTELINVFERLLHADDAKSQKTLALASKTDNNSSGSKKSEGKKKKKKGKREPKPDDICHNCG
DKGHWSNSCPKPKKSKPTENANVAVDEPGSSREVGNVYMATQPTGIPSGLLLDSAASCHMVADRSLFIEYHTQVN
QHISVGGSNKIPVVGKGKIKFHTSCPDGVSDVTLDGVLHIPTLGANLISLGKLHRLGAEVRGLPNGIAVIWQGTI
VFHAILIGKEGTLYRIHSFDQNDGDYSYLASSNHTSMRLWHRRLAHLGHRGIKEMADNNLVKGLKIDTPNDFDEL
CDACVNGKSHRTPFPKTSNTEYSKMELLVMDVFGPLQTSTWDGYLYALVVVEASTRFAVGRLLRSKSEVGEAVRD
IVAMLERQSGLKAKRLRSDVGNEFVNNAMDIFCRRNGIIHETTIPYNPEQNGIAEHAIAVYLQMMRCMLWAAKID
LRYWGEAFMYAVYIRSITLTSALKGKVPYEAWYGRKPDVSHLRIFGSYGWAHVTKEVRKGKLDSRAVRVRMLGWW
ADESKGYRLEDLENGKLIASRDVKFDEDSSPSNVASIDISLPHSTGQEIIDLTRLDEEPSPHEVVISQPTTPATP
SNGGTPVERPQSPKPPPPNTPKKSTKWQDLPKRDPSTRERHQTKRYGFGDKNEPSDSYVAFVATSGPSYSEAMAS
AEAKGWQEAVEKEYDQLARKGVFEEVDELPDGKKAVGSKVVLREKLDEHGNHVKFKARLVAQGFSQIPGVDFHET
FSSVAKFATLRVFLSLAAILDLEIHQVDIVGAYLEGDLDEEIYMKAPEGVGEGKKYWRLKKALYGLKQAGRQWKH
KLHEVLTNLGFERTRADDCLYVFRVDGKIVLLVLVYVDDMAVAGKNLSRIVSFKNGLAHEFDITDLGEIHYILGL
LIIRDRANRRIYLNQTGYIEAILKRFGMAESTPVAIPLATNHNLSLTQCPESAEELEAYQKFSKGINYLSMVGSL
LYATQTRPDIQYAVGIVAQYAANPGITHFAACKRILRYLRGTKDFSLMLGDLNDDGIQLVGWSDANWAGDLDDRK
SVSGYSFDIDGGTVSWSSKKQRVVATSTVEAEYIASSNATREAIWLRTLLSELDYPQSTTIIHTDSAGNIALSNN
PVAHSRAKHIDIRYHFIRDHIERKDVELKYVTTKSMVADIFTKALPRDLFTRFREVLGVIDTGVSSSGSVKECAE
STEVDDVKE*
Coding >AgabiH97|096660
ATGCAACGTCAGGTTATGGGCCCCGGTTTGGGCGAAAACACTTCTGAGACCTTGCAGTTTCCGAAGTTTAACGGT
ACCAATTATCATGTTTGGTCCGATAACGTGAAATCGGCCCTTCAAGCTAAGTCAGTTTGGGGTATTACTTCACGC
CGAGAGAAATGTCCTCCCAAGCCTCCGGATGAATATCCAGGCCATTATATTGCTATAACTGTTACGGACGAGGAT
GGAAAATCGACGTCCACTAGAACTCGAAAGGAAGGTCAAGCCCTTGTCGATGCCATGGAGTCGAAGGGATATCAA
GTCTGGGAACAGGGAGTCGAGAAGTACGAGAGATGGTTGAATCGAGATGACATGGCAATGGGTTTGATTCGAAAT
TCCATCGAATATACTCAACGCGAGTCTGTAATCGACTGTCAAACTTCAGCAGAAATGTGGGACCATCTTCATGAA
GTCTACGTTGATCAGCAAAGTGGGATTAACATCCATTTTTACTATCAAGAGCTTTATGCGAAGAAGTGGGACGGA
CATTCTTCCATGTCCGACCATATTGGGTTCTACCTCAATATTCGTCGCCGTATCATCGAGACTGGCAATCACATT
GATGATCATGCTATCATTAGTGCTATTCTACTCTCCCTTCCTTCAACGCCGACCTGGGAAGTTGTCAAACAGAAT
CTTCTCTATAAAGAGGATCGGCTTACTCTCGACATTGTCTCAACTGAATTGATCAACGTTTTCGAACGTTTACTT
CATGCTGATGATGCTAAGAGCCAGAAGACGCTTGCTCTTGCCTCGAAGACGGATAATAATTCTAGTGGGAGCAAG
AAGTCAGAAGGGAAGAAAAAGAAGAAGAAGGGGAAACGAGAACCCAAACCGGATGATATTTGTCACAATTGTGGT
GATAAAGGTCATTGGAGCAATAGTTGTCCCAAGCCGAAGAAATCTAAGCCAACCGAAAATGCGAATGTCGCTGTT
GATGAACCTGGGTCTAGTCGTGAAGTTGGAAATGTCTATATGGCTACCCAACCTACCGGAATTCCGTCTGGTCTG
CTTCTTGACAGCGCCGCTTCATGTCACATGGTTGCTGATCGTTCCCTTTTCATCGAGTATCACACTCAAGTTAAC
CAGCACATTTCCGTGGGGGGTTCTAATAAAATCCCTGTTGTCGGAAAAGGGAAAATCAAGTTTCACACTTCTTGT
CCTGACGGTGTTAGCGATGTCACACTTGACGGAGTTCTTCATATTCCTACTCTTGGAGCAAATTTGATTAGTCTC
GGGAAGTTGCATCGTTTGGGAGCTGAAGTTAGGGGCCTACCGAATGGTATTGCCGTGATCTGGCAAGGCACAATC
GTCTTCCACGCAATATTGATTGGAAAGGAAGGGACTTTGTATCGAATTCATTCCTTTGATCAAAATGATGGTGAC
TATTCTTATTTGGCAAGCAGTAATCATACCTCAATGCGCCTCTGGCACCGTCGTTTGGCCCATCTTGGTCATCGT
GGTATCAAAGAAATGGCCGATAACAATTTGGTTAAAGGTCTTAAAATTGATACACCTAACGACTTCGATGAGCTC
TGTGATGCTTGCGTAAATGGAAAATCTCACCGTACTCCATTTCCGAAGACGAGTAACACCGAGTATTCTAAGATG
GAGTTGTTGGTGATGGACGTATTCGGCCCGCTTCAAACTAGTACCTGGGATGGCTATTTGTATGCACTCGTGGTT
GTTGAGGCCAGTACTCGTTTTGCTGTCGGGAGGTTATTGAGAAGTAAAAGTGAAGTCGGAGAGGCCGTTCGTGAT
ATAGTTGCGATGTTGGAAAGGCAGTCGGGATTGAAAGCAAAGCGTTTGAGATCTGACGTCGGAAATGAATTTGTC
AACAACGCAATGGACATCTTTTGCCGACGAAATGGAATCATACACGAGACGACCATACCTTACAATCCAGAGCAA
AATGGTATAGCCGAGCATGCTATAGCCGTTTATCTCCAGATGATGAGGTGTATGTTATGGGCAGCCAAAATTGAT
CTTCGTTATTGGGGCGAAGCGTTCATGTATGCTGTTTATATTCGATCCATTACTCTAACTTCTGCTTTGAAAGGA
AAGGTTCCTTATGAAGCATGGTACGGTCGTAAACCCGATGTCTCTCATCTTCGTATCTTTGGATCCTATGGCTGG
GCTCATGTCACAAAAGAGGTTCGTAAAGGGAAACTTGATTCACGAGCAGTTCGTGTTCGAATGCTGGGGTGGTGG
GCTGATGAATCCAAGGGATATCGTCTTGAAGACTTGGAGAATGGGAAGTTAATTGCTTCTCGGGACGTAAAGTTT
GATGAAGACAGTTCGCCGAGCAATGTTGCATCGATTGACATTAGTCTTCCTCATTCAACAGGACAAGAGATAATC
GATCTCACTAGGTTAGATGAAGAACCTTCTCCTCACGAAGTTGTCATCTCTCAACCTACTACTCCCGCTACACCT
TCCAATGGTGGTACTCCTGTTGAACGTCCCCAATCTCCAAAGCCTCCACCACCTAATACTCCAAAGAAGTCTACC
AAATGGCAAGATTTGCCGAAACGAGACCCTTCTACTCGTGAACGTCATCAAACCAAACGATATGGTTTTGGTGAC
AAGAACGAACCTTCGGACAGTTATGTAGCATTTGTCGCTACATCTGGTCCTTCATATTCCGAAGCTATGGCTTCA
GCGGAAGCTAAGGGATGGCAGGAAGCTGTCGAAAAGGAGTATGATCAATTAGCTCGAAAGGGAGTGTTCGAGGAG
GTTGATGAATTACCTGATGGTAAGAAAGCTGTCGGAAGTAAAGTCGTGTTGCGAGAGAAGCTTGATGAACATGGA
AATCATGTCAAGTTTAAGGCTAGGCTCGTCGCTCAAGGATTTTCACAGATTCCTGGAGTTGATTTCCATGAAACT
TTCTCTTCAGTTGCGAAATTCGCAACACTTCGAGTCTTTCTCTCTCTGGCAGCCATTCTTGACCTTGAAATTCAT
CAAGTTGACATTGTAGGAGCGTATCTCGAGGGTGATCTTGACGAGGAAATTTATATGAAGGCGCCAGAAGGAGTT
GGTGAAGGGAAGAAATATTGGCGGTTGAAGAAAGCACTGTATGGTCTAAAACAAGCAGGACGTCAGTGGAAGCAC
AAGCTTCATGAAGTTCTTACCAACCTTGGATTTGAACGAACTCGTGCCGACGACTGTCTTTATGTTTTTCGTGTG
GACGGAAAAATTGTCTTGCTTGTCTTGGTATATGTTGACGACATGGCAGTAGCTGGAAAGAACCTCAGTAGGATC
GTTTCATTCAAGAATGGTCTTGCTCATGAGTTCGATATAACAGACCTTGGTGAAATCCATTATATCTTAGGTCTG
CTCATAATCCGGGACCGCGCTAATCGTCGCATCTACCTAAATCAAACTGGTTATATCGAAGCCATTTTGAAGCGC
TTTGGAATGGCGGAGTCGACACCGGTCGCCATTCCCCTTGCGACCAACCATAATCTTTCGCTTACACAATGTCCT
GAAAGTGCCGAAGAATTAGAGGCTTATCAAAAGTTCTCTAAAGGCATCAATTACCTTTCAATGGTCGGCTCTCTC
CTCTACGCTACCCAAACTCGTCCCGACATCCAGTATGCAGTTGGAATCGTTGCGCAATATGCCGCTAATCCGGGT
ATTACTCATTTTGCTGCCTGCAAGAGAATCCTTCGTTATTTGAGAGGTACAAAGGATTTTTCATTGATGTTAGGA
GATTTAAATGATGACGGGATACAACTGGTCGGCTGGAGTGATGCGAATTGGGCTGGGGATTTGGATGATAGAAAG
TCCGTGAGTGGCTATTCTTTCGATATTGACGGAGGAACGGTTTCTTGGTCTTCTAAGAAACAGCGAGTCGTCGCT
ACCTCGACCGTTGAAGCTGAATATATAGCTTCGTCAAATGCCACCAGAGAGGCAATTTGGTTACGCACCTTGTTG
TCGGAACTCGACTATCCCCAATCCACCACAATCATCCACACTGACAGCGCAGGCAATATAGCCCTATCCAATAAT
CCAGTTGCTCATTCGAGAGCGAAACATATCGATATTCGCTACCATTTTATTCGAGACCACATTGAACGGAAGGAC
GTTGAGTTGAAGTATGTAACAACCAAGTCGATGGTTGCTGACATTTTCACGAAAGCGTTGCCACGTGATTTGTTC
ACCCGGTTCCGAGAAGTTCTTGGCGTTATTGATACAGGTGTCTCGTCGAGTGGGAGTGTTAAAGAGTGCGCCGAG
AGCACTGAAGTTGACGACGTGAAGGAATAG
Transcript >AgabiH97|096660
ATGCAACGTCAGGTTATGGGCCCCGGTTTGGGCGAAAACACTTCTGAGACCTTGCAGTTTCCGAAGTTTAACGGT
ACCAATTATCATGTTTGGTCCGATAACGTGAAATCGGCCCTTCAAGCTAAGTCAGTTTGGGGTATTACTTCACGC
CGAGAGAAATGTCCTCCCAAGCCTCCGGATGAATATCCAGGCCATTATATTGCTATAACTGTTACGGACGAGGAT
GGAAAATCGACGTCCACTAGAACTCGAAAGGAAGGTCAAGCCCTTGTCGATGCCATGGAGTCGAAGGGATATCAA
GTCTGGGAACAGGGAGTCGAGAAGTACGAGAGATGGTTGAATCGAGATGACATGGCAATGGGTTTGATTCGAAAT
TCCATCGAATATACTCAACGCGAGTCTGTAATCGACTGTCAAACTTCAGCAGAAATGTGGGACCATCTTCATGAA
GTCTACGTTGATCAGCAAAGTGGGATTAACATCCATTTTTACTATCAAGAGCTTTATGCGAAGAAGTGGGACGGA
CATTCTTCCATGTCCGACCATATTGGGTTCTACCTCAATATTCGTCGCCGTATCATCGAGACTGGCAATCACATT
GATGATCATGCTATCATTAGTGCTATTCTACTCTCCCTTCCTTCAACGCCGACCTGGGAAGTTGTCAAACAGAAT
CTTCTCTATAAAGAGGATCGGCTTACTCTCGACATTGTCTCAACTGAATTGATCAACGTTTTCGAACGTTTACTT
CATGCTGATGATGCTAAGAGCCAGAAGACGCTTGCTCTTGCCTCGAAGACGGATAATAATTCTAGTGGGAGCAAG
AAGTCAGAAGGGAAGAAAAAGAAGAAGAAGGGGAAACGAGAACCCAAACCGGATGATATTTGTCACAATTGTGGT
GATAAAGGTCATTGGAGCAATAGTTGTCCCAAGCCGAAGAAATCTAAGCCAACCGAAAATGCGAATGTCGCTGTT
GATGAACCTGGGTCTAGTCGTGAAGTTGGAAATGTCTATATGGCTACCCAACCTACCGGAATTCCGTCTGGTCTG
CTTCTTGACAGCGCCGCTTCATGTCACATGGTTGCTGATCGTTCCCTTTTCATCGAGTATCACACTCAAGTTAAC
CAGCACATTTCCGTGGGGGGTTCTAATAAAATCCCTGTTGTCGGAAAAGGGAAAATCAAGTTTCACACTTCTTGT
CCTGACGGTGTTAGCGATGTCACACTTGACGGAGTTCTTCATATTCCTACTCTTGGAGCAAATTTGATTAGTCTC
GGGAAGTTGCATCGTTTGGGAGCTGAAGTTAGGGGCCTACCGAATGGTATTGCCGTGATCTGGCAAGGCACAATC
GTCTTCCACGCAATATTGATTGGAAAGGAAGGGACTTTGTATCGAATTCATTCCTTTGATCAAAATGATGGTGAC
TATTCTTATTTGGCAAGCAGTAATCATACCTCAATGCGCCTCTGGCACCGTCGTTTGGCCCATCTTGGTCATCGT
GGTATCAAAGAAATGGCCGATAACAATTTGGTTAAAGGTCTTAAAATTGATACACCTAACGACTTCGATGAGCTC
TGTGATGCTTGCGTAAATGGAAAATCTCACCGTACTCCATTTCCGAAGACGAGTAACACCGAGTATTCTAAGATG
GAGTTGTTGGTGATGGACGTATTCGGCCCGCTTCAAACTAGTACCTGGGATGGCTATTTGTATGCACTCGTGGTT
GTTGAGGCCAGTACTCGTTTTGCTGTCGGGAGGTTATTGAGAAGTAAAAGTGAAGTCGGAGAGGCCGTTCGTGAT
ATAGTTGCGATGTTGGAAAGGCAGTCGGGATTGAAAGCAAAGCGTTTGAGATCTGACGTCGGAAATGAATTTGTC
AACAACGCAATGGACATCTTTTGCCGACGAAATGGAATCATACACGAGACGACCATACCTTACAATCCAGAGCAA
AATGGTATAGCCGAGCATGCTATAGCCGTTTATCTCCAGATGATGAGGTGTATGTTATGGGCAGCCAAAATTGAT
CTTCGTTATTGGGGCGAAGCGTTCATGTATGCTGTTTATATTCGATCCATTACTCTAACTTCTGCTTTGAAAGGA
AAGGTTCCTTATGAAGCATGGTACGGTCGTAAACCCGATGTCTCTCATCTTCGTATCTTTGGATCCTATGGCTGG
GCTCATGTCACAAAAGAGGTTCGTAAAGGGAAACTTGATTCACGAGCAGTTCGTGTTCGAATGCTGGGGTGGTGG
GCTGATGAATCCAAGGGATATCGTCTTGAAGACTTGGAGAATGGGAAGTTAATTGCTTCTCGGGACGTAAAGTTT
GATGAAGACAGTTCGCCGAGCAATGTTGCATCGATTGACATTAGTCTTCCTCATTCAACAGGACAAGAGATAATC
GATCTCACTAGGTTAGATGAAGAACCTTCTCCTCACGAAGTTGTCATCTCTCAACCTACTACTCCCGCTACACCT
TCCAATGGTGGTACTCCTGTTGAACGTCCCCAATCTCCAAAGCCTCCACCACCTAATACTCCAAAGAAGTCTACC
AAATGGCAAGATTTGCCGAAACGAGACCCTTCTACTCGTGAACGTCATCAAACCAAACGATATGGTTTTGGTGAC
AAGAACGAACCTTCGGACAGTTATGTAGCATTTGTCGCTACATCTGGTCCTTCATATTCCGAAGCTATGGCTTCA
GCGGAAGCTAAGGGATGGCAGGAAGCTGTCGAAAAGGAGTATGATCAATTAGCTCGAAAGGGAGTGTTCGAGGAG
GTTGATGAATTACCTGATGGTAAGAAAGCTGTCGGAAGTAAAGTCGTGTTGCGAGAGAAGCTTGATGAACATGGA
AATCATGTCAAGTTTAAGGCTAGGCTCGTCGCTCAAGGATTTTCACAGATTCCTGGAGTTGATTTCCATGAAACT
TTCTCTTCAGTTGCGAAATTCGCAACACTTCGAGTCTTTCTCTCTCTGGCAGCCATTCTTGACCTTGAAATTCAT
CAAGTTGACATTGTAGGAGCGTATCTCGAGGGTGATCTTGACGAGGAAATTTATATGAAGGCGCCAGAAGGAGTT
GGTGAAGGGAAGAAATATTGGCGGTTGAAGAAAGCACTGTATGGTCTAAAACAAGCAGGACGTCAGTGGAAGCAC
AAGCTTCATGAAGTTCTTACCAACCTTGGATTTGAACGAACTCGTGCCGACGACTGTCTTTATGTTTTTCGTGTG
GACGGAAAAATTGTCTTGCTTGTCTTGGTATATGTTGACGACATGGCAGTAGCTGGAAAGAACCTCAGTAGGATC
GTTTCATTCAAGAATGGTCTTGCTCATGAGTTCGATATAACAGACCTTGGTGAAATCCATTATATCTTAGGTCTG
CTCATAATCCGGGACCGCGCTAATCGTCGCATCTACCTAAATCAAACTGGTTATATCGAAGCCATTTTGAAGCGC
TTTGGAATGGCGGAGTCGACACCGGTCGCCATTCCCCTTGCGACCAACCATAATCTTTCGCTTACACAATGTCCT
GAAAGTGCCGAAGAATTAGAGGCTTATCAAAAGTTCTCTAAAGGCATCAATTACCTTTCAATGGTCGGCTCTCTC
CTCTACGCTACCCAAACTCGTCCCGACATCCAGTATGCAGTTGGAATCGTTGCGCAATATGCCGCTAATCCGGGT
ATTACTCATTTTGCTGCCTGCAAGAGAATCCTTCGTTATTTGAGAGGTACAAAGGATTTTTCATTGATGTTAGGA
GATTTAAATGATGACGGGATACAACTGGTCGGCTGGAGTGATGCGAATTGGGCTGGGGATTTGGATGATAGAAAG
TCCGTGAGTGGCTATTCTTTCGATATTGACGGAGGAACGGTTTCTTGGTCTTCTAAGAAACAGCGAGTCGTCGCT
ACCTCGACCGTTGAAGCTGAATATATAGCTTCGTCAAATGCCACCAGAGAGGCAATTTGGTTACGCACCTTGTTG
TCGGAACTCGACTATCCCCAATCCACCACAATCATCCACACTGACAGCGCAGGCAATATAGCCCTATCCAATAAT
CCAGTTGCTCATTCGAGAGCGAAACATATCGATATTCGCTACCATTTTATTCGAGACCACATTGAACGGAAGGAC
GTTGAGTTGAAGTATGTAACAACCAAGTCGATGGTTGCTGACATTTTCACGAAAGCGTTGCCACGTGATTTGTTC
ACCCGGTTCCGAGAAGTTCTTGGCGTTATTGATACAGGTGTCTCGTCGAGTGGGAGTGTTAAAGAGTGCGCCGAG
AGCACTGAAGTTGACGACGTGAAGGAATAG
Gene >AgabiH97|096660
ATGCAACGTCAGGTTATGGGCCCCGGTTTGGGCGAAAACACTTCTGAGACCTTGCAGTTTCCGAAGTTTAACGGT
ACCAATTATCATGTTTGGTCCGATAACGTGAAATCGGCCCTTCAAGCTAAGTCAGTTTGGGGTATTACTTCACGC
CGAGAGAAATGTCCTCCCAAGCCTCCGGATGAATATCCAGGCCATTATATTGCTATAACTGTTACGGACGAGGAT
GGAAAATCGACGTCCACTAGAACTCGAAAGGAAGGTCAAGCCCTTGTCGATGCCATGGAGTCGAAGGGATATCAA
GTCTGGGAACAGGGAGTCGAGAAGTACGAGAGATGGTTGAATCGAGATGACATGGCAATGGGTTTGATTCGAAAT
TCCATCGAATATACTCAACGCGAGTCTGTAATCGACTGTCAAACTTCAGCAGAAATGTGGGACCATCTTCATGAA
GTCTACGTTGATCAGCAAAGTGGGATTAACATCCATTTTTACTATCAAGAGCTTTATGCGAAGAAGTGGGACGGA
CATTCTTCCATGTCCGACCATATTGGGTTCTACCTCAATATTCGTCGCCGTATCATCGAGACTGGCAATCACATT
GATGATCATGCTATCATTAGTGCTATTCTACTCTCCCTTCCTTCAACGCCGACCTGGGAAGTTGTCAAACAGAAT
CTTCTCTATAAAGAGGATCGGCTTACTCTCGACATTGTCTCAACTGAATTGATCAACGTTTTCGAACGTTTACTT
CATGCTGATGATGCTAAGAGCCAGAAGACGCTTGCTCTTGCCTCGAAGACGGATAATAATTCTAGTGGGAGCAAG
AAGTCAGAAGGGAAGAAAAAGAAGAAGAAGGGGAAACGAGAACCCAAACCGGATGATATTTGTCACAATTGTGGT
GATAAAGGTCATTGGAGCAATAGTTGTCCCAAGCCGAAGAAATCTAAGCCAACCGAAAATGCGAATGTCGCTGTT
GATGAACCTGGGTCTAGTCGTGAAGTTGGAAATGTCTATATGGCTACCCAACCTACCGGAATTCCGTCTGGTCTG
CTTCTTGACAGCGCCGCTTCATGTCACATGGTTGCTGATCGTTCCCTTTTCATCGAGTATCACACTCAAGTTAAC
CAGCACATTTCCGTGGGGGGTTCTAATAAAATCCCTGTTGTCGGAAAAGGGAAAATCAAGTTTCACACTTCTTGT
CCTGACGGTGTTAGCGATGTCACACTTGACGGAGTTCTTCATATTCCTACTCTTGGAGCAAATTTGATTAGTCTC
GGGAAGTTGCATCGTTTGGGAGCTGAAGTTAGGGGCCTACCGAATGGTATTGCCGTGATCTGGCAAGGCACAATC
GTCTTCCACGCAATATTGATTGGAAAGGAAGGGACTTTGTATCGAATTCATTCCTTTGATCAAAATGATGGTGAC
TATTCTTATTTGGCAAGCAGTAATCATACCTCAATGCGCCTCTGGCACCGTCGTTTGGCCCATCTTGGTCATCGT
GGTATCAAAGAAATGGCCGATAACAATTTGGTTAAAGGTCTTAAAATTGATACACCTAACGACTTCGATGAGCTC
TGTGATGCTTGCGTAAATGGAAAATCTCACCGTACTCCATTTCCGAAGACGAGTAACACCGAGTATTCTAAGATG
GAGTTGTTGGTGATGGACGTATTCGGCCCGCTTCAAACTAGTACCTGGGATGGCTATTTGTATGCACTCGTGGTT
GTTGAGGCCAGTACTCGTTTTGCTGTCGGGAGGTTATTGAGAAGTAAAAGTGAAGTCGGAGAGGCCGTTCGTGAT
ATAGTTGCGATGTTGGAAAGGCAGTCGGGATTGAAAGCAAAGCGTTTGAGATCTGACGTCGGAAATGAATTTGTC
AACAACGCAATGGACATCTTTTGCCGACGAAATGGAATCATACACGAGACGACCATACCTTACAATCCAGAGCAA
AATGGTATAGCCGAGCATGCTATAGCCGTTTATCTCCAGATGATGAGGTGTATGTTATGGGCAGCCAAAATTGAT
CTTCGTTATTGGGGCGAAGCGTTCATGTATGCTGTTTATATTCGATCCATTACTCTAACTTCTGCTTTGAAAGGA
AAGGTTCCTTATGAAGCATGGTACGGTCGTAAACCCGATGTCTCTCATCTTCGTATCTTTGGATCCTATGGCTGG
GCTCATGTCACAAAAGAGGTTCGTAAAGGGAAACTTGATTCACGAGCAGTTCGTGTTCGAATGCTGGGGTGGTGG
GCTGATGAATCCAAGGGATATCGTCTTGAAGACTTGGAGAATGGGAAGTTAATTGCTTCTCGGGACGTAAAGTTT
GATGAAGACAGTTCGCCGAGCAATGTTGCATCGATTGACATTAGTCTTCCTCATTCAACAGGACAAGAGATAATC
GATCTCACTAGGTTAGATGAAGAACCTTCTCCTCACGAAGTTGTCATCTCTCAACCTACTACTCCCGCTACACCT
TCCAATGGTGGTACTCCTGTTGAACGTCCCCAATCTCCAAAGCCTCCACCACCTAATACTCCAAAGAAGTCTACC
AAATGGCAAGATTTGCCGAAACGAGACCCTTCTACTCGTGAACGTCATCAAACCAAACGATATGGTTTTGGTGAC
AAGAACGAACCTTCGGACAGTTATGTAGCATTTGTCGCTACATCTGGTCCTTCATATTCCGAAGCTATGGCTTCA
GCGGAAGCTAAGGGATGGCAGGAAGCTGTCGAAAAGGAGTATGATCAATTAGCTCGAAAGGGAGTGTTCGAGGAG
GTTGATGAATTACCTGATGGTAAGAAAGCTGTCGGAAGTAAAGTCGTGTTGCGAGAGAAGCTTGATGAACATGGA
AATCATGTCAAGTTTAAGGCTAGGCTCGTCGCTCAAGGATTTTCACAGATTCCTGGAGTTGATTTCCATGAAACT
TTCTCTTCAGTTGCGAAATTCGCAACACTTCGAGTCTTTCTCTCTCTGGCAGCCATTCTTGACCTTGAAATTCAT
CAAGTTGACATTGTAGGAGCGTATCTCGAGGGTGATCTTGACGAGGAAATTTATATGAAGGCGCCAGAAGGAGTT
GGTGAAGGGAAGAAATATTGGCGGTTGAAGAAAGCACTGTATGGTCTAAAACAAGCAGGACGTCAGTGGAAGCAC
AAGCTTCATGAAGTTCTTACCAACCTTGGATTTGAACGAACTCGTGCCGACGACTGTCTTTATGTTTTTCGTGTG
GACGGAAAAATTGTCTTGCTTGTCTTGGTATATGTTGACGACATGGCAGTAGCTGGAAAGAACCTCAGTAGGATC
GTTTCATTCAAGAATGGTCTTGCTCATGAGTTCGATATAACAGACCTTGGTGAAATCCATTATATCTTAGGTCTG
CTCATAATCCGGGACCGCGCTAATCGTCGCATCTACCTAAATCAAACTGGTTATATCGAAGCCATTTTGAAGCGC
TTTGGAATGGCGGAGTCGACACCGGTCGCCATTCCCCTTGCGACCAACCATAATCTTTCGCTTACACAATGTCCT
GAAAGTGCCGAAGAATTAGAGGCTTATCAAAAGTTCTCTAAAGGCATCAATTACCTTTCAATGGTCGGCTCTCTC
CTCTACGCTACCCAAACTCGTCCCGACATCCAGTATGCAGTTGGAATCGTTGCGCAATATGCCGCTAATCCGGGT
ATTACTCATTTTGCTGCCTGCAAGAGAATCCTTCGTTATTTGAGAGGTACAAAGGATTTTTCATTGATGTTAGGA
GATTTAAATGATGACGGGATACAACTGGTCGGCTGGAGTGATGCGAATTGGGCTGGGGATTTGGATGATAGAAAG
TCCGTGAGTGGCTATTCTTTCGATATTGACGGAGGAACGGTTTCTTGGTCTTCTAAGAAACAGCGAGTCGTCGCT
ACCTCGACCGTTGAAGCTGAATATATAGCTTCGTCAAATGCCACCAGAGAGGCAATTTGGTTACGCACCTTGTTG
TCGGAACTCGACTATCCCCAATCCACCACAATCATCCACACTGACAGCGCAGGCAATATAGCCCTATCCAATAAT
CCAGTTGCTCATTCGAGAGCGAAACATATCGATATTCGCTACCATTTTATTCGAGACCACATTGAACGGAAGGAC
GTTGAGTTGAAGTATGTAACAACCAAGTCGATGGTTGCTGACATTTTCACGAAAGCGTTGCCACGTGATTTGTTC
ACCCGGTTCCGAGAAGTTCTTGGCGTTATTGATACAGGTGTCTCGTCGAGTGGGAGTGTTAAAGAGTGCGCCGAG
AGCACTGAAGTTGACGACGTGAAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail