Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|096570
Gene name
Locationscaffold_6:2114884..2116804
Strand+
Gene length (bp)1920
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 2.7E-24 168 395

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|096570
MTRLFVAWILMLLPAFGLAQDLGVPLSWRKFSNSRPLNERISIAQNGINTILPQLDGGIGEFNGIGYWQSGNVWT
VMANQDRYAGTTVNRARVVNNLNLVFNIRQNYDRFEVSSFNDDALWWAQAAIAGFRAYRDNNLLSHAVATWNHVT
NYVITADQASSGRVPLKNFQISGRCEGTTMAGGVFWRPTADTTPINSITTGLYITTSALLAEITGDRKYTDAAIL
SAQWIRNHNINSNRIVLDTVDARDCSRSPASWLFTYNSGKYIEGLSVLADVTGDSQWRSLMITTVAAAVKNAPWQ
GSDGIITEGVSTSSNNDGVGFKAIFIRGLAEAFARNPSNNDLRILLHSYIDVQYNALLDLAANGNSYSSNWRGPP
QGFTTWGQLAALDVLTSAIIAN*
Coding >AgabiH97|096570
ATGACGAGGCTTTTTGTTGCTTGGATTTTGATGCTTTTGCCTGCATTTGGGCTTGCTCAGGATTTAGGCGTTCCT
TTGAGTTGGCGGAAATTCAGCAATAGCCGTCCTTTGAATGAAAGGATATCTATCGCGCAAAATGGCATCAACACC
ATTTTGCCACAACTAGACGGTGGTATTGGGGAATTCAACGGAATTGGGTACTGGCAGAGTGGGAATGTATGGACC
GTCATGGCAAATCAAGATCGCTACGCCGGGACGACAGTGAATCGAGCACGAGTCGTGAATAATTTGAATTTGGTC
TTCAATATCAGGCAGAACTATGATCGATTTGAAGTAAGTTCTTTCAACGATGATGCATTGTGGTGGGCACAAGCC
GCAATTGCAGGCTTCCGTGCATACAGAGACAATAATCTCCTCTCGCATGCAGTCGCAACTTGGAACCATGTGACG
AATTATGTTATTACAGCGGATCAAGCTTCATCAGGCCGTGTTCCCCTCAAGAATTTCCAAATATCTGGGCGGTGC
GAAGGCACGACTATGGCGGGTGGTGTTTTCTGGCGCCCTACAGCAGATACTACTCCTATCAATTCCATAACCACC
GGGTTGTACATTACCACGTCGGCCCTCCTGGCAGAGATTACTGGCGACCGTAAATATACTGATGCGGCCATTTTG
AGTGCTCAGTGGATCAGAAATCATAATATCAACAGTAACCGTATTGTTCTGGATACCGTTGATGCGAGGGATTGT
TCACGGTCTCCGGCGTCGTGGTTGTTCACTTACAATAGCGGAAAATACATCGAAGGACTAAGCGTCCTCGCAGAT
GTTACCGGTGATTCGCAGTGGCGATCTCTTATGATCACAACTGTGGCGGCCGCCGTGAAGAATGCGCCTTGGCAA
GGTTCTGATGGTATTATTACGGAGGGCGTAAGTACGTCCAGCAACAACGATGGCGTTGGATTCAAAGCCATTTTC
ATTCGCGGTTTGGCAGAGGCTTTTGCCCGAAATCCTTCCAATAATGATCTGCGCATCTTATTGCATAGTTATATT
GACGTTCAGTATAATGCCCTACTCGATTTGGCAGCTAATGGCAACAGCTACTCGTCTAATTGGCGCGGACCACCC
CAAGGATTCACCACTTGGGGTCAGTTGGCCGCACTCGATGTGCTCACAAGTGCTATCATTGCCAATTGA
Transcript >AgabiH97|096570
ATGACGAGGCTTTTTGTTGCTTGGATTTTGATGCTTTTGCCTGCATTTGGGCTTGCTCAGGATTTAGGCGTTCCT
TTGAGTTGGCGGAAATTCAGCAATAGCCGTCCTTTGAATGAAAGGATATCTATCGCGCAAAATGGCATCAACACC
ATTTTGCCACAACTAGACGGTGGTATTGGGGAATTCAACGGAATTGGGTACTGGCAGAGTGGGAATGTATGGACC
GTCATGGCAAATCAAGATCGCTACGCCGGGACGACAGTGAATCGAGCACGAGTCGTGAATAATTTGAATTTGGTC
TTCAATATCAGGCAGAACTATGATCGATTTGAAGTAAGTTCTTTCAACGATGATGCATTGTGGTGGGCACAAGCC
GCAATTGCAGGCTTCCGTGCATACAGAGACAATAATCTCCTCTCGCATGCAGTCGCAACTTGGAACCATGTGACG
AATTATGTTATTACAGCGGATCAAGCTTCATCAGGCCGTGTTCCCCTCAAGAATTTCCAAATATCTGGGCGGTGC
GAAGGCACGACTATGGCGGGTGGTGTTTTCTGGCGCCCTACAGCAGATACTACTCCTATCAATTCCATAACCACC
GGGTTGTACATTACCACGTCGGCCCTCCTGGCAGAGATTACTGGCGACCGTAAATATACTGATGCGGCCATTTTG
AGTGCTCAGTGGATCAGAAATCATAATATCAACAGTAACCGTATTGTTCTGGATACCGTTGATGCGAGGGATTGT
TCACGGTCTCCGGCGTCGTGGTTGTTCACTTACAATAGCGGAAAATACATCGAAGGACTAAGCGTCCTCGCAGAT
GTTACCGGTGATTCGCAGTGGCGATCTCTTATGATCACAACTGTGGCGGCCGCCGTGAAGAATGCGCCTTGGCAA
GGTTCTGATGGTATTATTACGGAGGGCGTAAGTACGTCCAGCAACAACGATGGCGTTGGATTCAAAGCCATTTTC
ATTCGCGGTTTGGCAGAGGCTTTTGCCCGAAATCCTTCCAATAATGATCTGCGCATCTTATTGCATAGTTATATT
GACGTTCAGTATAATGCCCTACTCGATTTGGCAGCTAATGGCAACAGCTACTCGTCTAATTGGCGCGGACCACCC
CAAGGATTCACCACTTGGGGTCAGTTGGCCGCACTCGATGTGCTCACAAGTGCTATCATTGCCAATTGA
Gene >AgabiH97|096570
ATGACGAGGCTTTTTGTTGCTTGGATTTTGATGCTTTTGCCTGCATTTGGGCTTGCTCAGGATTTAGGCGTTCCT
TTGAGTTGGCGGGTTCGCATTTCTTATACTTGTGCTTCGGTGTTTTGCTGAATGAACTGGCTTGATAATTGAATG
TAGAAATTCAGCAATAGCCGTCCTTTGAATGAAAGGATATCTATCGCGCAAAATGGCATCAACACCATTTTGCCA
CAACTAGACGGTGGTATTGGGGAATTCAACGGTGAGTGAATCGTCTTCGTCATAACATTACCCAAGTTTTTTTGC
GAGTTGTCATTTATTTTATTGTTACATATTCAAGGAATTGGGTACTGGCAGAGTGGGAATGTATGGACCGTCATG
GCAAATCAAGATCGCTACGCCGGGACGACAGTGAATCGAGCACGAGTCGTGAATAATTTGAATTTGGTCTTCAAT
ATCAGGCAGAACTATGATCGATTTGAGTAAGTACCACTCGGGAATAAAGGTCTGGACGTAATGCTAATTTTTGTT
TAGAGTAAGTTCTGTTCGTAGTTGAGGCAACAGGTCTATCTCACTGTGTCGATATCCCACAGTTCAACGATGATG
CATTGTAAGGCACCTGTCGTCAACATATCATTCCCATTAAAACCTGACCCGACGAAACAGGTGGTGGGCACAAGC
CGCAATTGCAGGCTTCCGTGCATACAGAGACAATAATCTCCTCTCGCATGCAGTCGCAACTTGGAACCATGTGAC
GAATTAGTACGACACTCTAGTTCCTATTGTCATCTATATACCTGCACAACTGACTTTGAACAACATAGTGTTATT
ACAGCGGATCAAGCTTCATCAGGCCGTGTTCCCCTCAAGAATTTCCAAATATCTGGGCGGTGCGAAGGCAGTCAG
TATCCAAATTTGATCTCTTATCTAAGAAGCTAACAACTTTTATCAGCGACTATGGCGGGTGGTGTTTTCTGGGTG
AGAACTAACGTTGGTTCATGGTCTTGCTTCTCACCAGCTCTACAGCGCCCTACAGCAGATACTACTCCTATCAAT
TCCATAACCACCGGGTGAGGAATCCTGTTCCTTTAGATTGAGAAAGTTTCTCGTGTCTGACATAAGCATAGGTTG
TACATTACGTACGTCGTGAAGCTCAAAGAATGATTAAGAGACCTGACAATCATAAAGCACGTCGGCCCTCCTGGC
AGAGATTACTGGCGACCGTAAATATACTGATGCGGCCATTTTGAGTGCTCAGTGGATCAGAAATCATAATATCAA
CAGTAACCGTATTGTTCTGGATACCGTTGATGCGAGGGATTGTTCACGGTCTCCGGCGTCGTGGTTGTTCACTTA
CAATAGCGGAAAATACATCGAAGGACTAAGCGTCCTCGCAGATGTTACCGGTGATTCGCAGTGGCGATCTCTGTG
AGTACCCATATTTGTTGATGTGCGTATAACTACCATGAATGTTTTTAGTATGATCACAACTGTGGCGGCCGCCGT
GAAGAATGCGCCTTGGCAAGGTTCTGATGGTATTATTACGGAGGGCGTAAGTACGTCCAGCAACAACGATGGCGT
TGGATTCAAAGGTATGGAGTCAATTTCAGGTGAAAATTATGTATTCATATGTTCTACCTACAGCCATTTTCATTC
GCGGTTTGGCAGAGGCTTTTGCCCGAAATCCTTCCAATAATGATCTGCGCATCTTATTGCATAGTTATATTGACG
TTCAGGTTGGTGATTTCAGCGTCAAATTTCGGACTATTTGTTTGACACTGCACGCTATAGTATAATGCCCTACTC
GATTTGGCAGCTAATGGCAACAGCTACTCGTCTAATTGGCGCGGACCACCCCAAGGATTCACCACTTGGGGTCAG
TTGGCCGCACTCGATGTGCTCACAAGTGCTATCATTGCCAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail