Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|096270
Gene name
Locationscaffold_6:2043998..2044558
Strand+
Gene length (bp)560
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 1.2E-08 59 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 13 108 1.0E-26
sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 1 109 3.0E-25
sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 21 106 1.0E-21
sp|Q9W3Y0|ZN593_DROME Zinc finger protein 593 homolog OS=Drosophila melanogaster GN=CG3224 PE=2 SV=1 43 108 4.0E-20
sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2 1 129 9.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 13 108 1.0E-26
sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 1 109 3.0E-25
sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 21 106 1.0E-21
sp|Q9W3Y0|ZN593_DROME Zinc finger protein 593 homolog OS=Drosophila melanogaster GN=CG3224 PE=2 SV=1 43 108 4.0E-20
sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2 1 129 9.0E-19
sp|Q9DB42|ZN593_MOUSE Zinc finger protein 593 OS=Mus musculus GN=Znf593 PE=1 SV=2 1 129 4.0E-17
sp|Q9U239|ZN593_CAEEL Zinc finger protein 593 homolog OS=Caenorhabditis elegans GN=Y56A3A.18 PE=3 SV=1 12 108 3.0E-15
sp|Q553S1|ZN593_DICDI Zinc finger protein 593 homolog OS=Dictyostelium discoideum GN=DDB_G0275351 PE=3 SV=1 1 102 4.0E-15
sp|Q8SWF6|Z231_ENCCU Zinc finger C2H2 protein ECU02_0310 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0310 PE=3 SV=1 17 107 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|096270
MGRLRRSRTHHAQRDVRRASRTRARTRDLDQIQLIDLDPKNRAELEAQPLDYEKPGLAQHYCVECAKYFETDHAL
KSHWRSKVHKRRCKQLREPVYTIEEAERAAGLGKEGKRPVREAVLDAEMSTTTPT*
Coding >AgabiH97|096270
ATGGGCCGTCTGCGCCGTTCGAGAACTCATCATGCACAGCGAGATGTTCGCAGAGCATCCAGGACACGAGCTCGG
ACACGAGATCTGGACCAAATACAACTTATTGATTTAGATCCCAAAAATAGAGCTGAGCTTGAGGCTCAACCTCTT
GATTATGAAAAGCCTGGACTTGCTCAACATTACTGCGTCGAATGTGCAAAATACTTTGAGACAGACCATGCTCTA
AAATCTCACTGGCGGAGTAAAGTCCACAAACGACGGTGTAAACAGCTACGAGAACCCGTGTATACCATAGAAGAA
GCTGAAAGAGCTGCAGGGTTAGGGAAGGAGGGAAAACGACCGGTGAGAGAGGCTGTATTGGATGCCGAGATGAGT
ACTACGACTCCTACATGA
Transcript >AgabiH97|096270
ATGGGCCGTCTGCGCCGTTCGAGAACTCATCATGCACAGCGAGATGTTCGCAGAGCATCCAGGACACGAGCTCGG
ACACGAGATCTGGACCAAATACAACTTATTGATTTAGATCCCAAAAATAGAGCTGAGCTTGAGGCTCAACCTCTT
GATTATGAAAAGCCTGGACTTGCTCAACATTACTGCGTCGAATGTGCAAAATACTTTGAGACAGACCATGCTCTA
AAATCTCACTGGCGGAGTAAAGTCCACAAACGACGGTGTAAACAGCTACGAGAACCCGTGTATACCATAGAAGAA
GCTGAAAGAGCTGCAGGGTTAGGGAAGGAGGGAAAACGACCGGTGAGAGAGGCTGTATTGGATGCCGAGATGAGT
ACTACGACTCCTACATGA
Gene >AgabiH97|096270
ATGGGCCGTCTGCGCCGTTCGAGAACTCATCATGCACAGCGAGATGTTCGCAGAGCATCCAGGACACGAGTATGT
TTTTACGGAACGGAGATAGAAAAAACCTTGACCGAATTTCTCTTAGGCTCGGACACGAGATCTGGACCAAATACA
ACTTATTGATTTAGATCCCAAAGTACGAAAACAAACCTTGCTTTCATCGAATTTAATCTGAGATGAGGCTGTAGA
ATAGAGCTGAGCTTGAGGCTCAACCTCTTGATTATGAAAAGCCTGGACTTGCTCAACATTACTGCGTCGAATGTG
CAAAGTTCGTCATCTTCAATTTTTTTGTCCCGTCGTGAATTCACATCGTCGTCTTTCTGTTTAACAGATACTTTG
AGACAGACCATGCTCTAAAATCTCACTGGCGGAGTAAAGTCCACAAACGACGGTGTAAACAGCTACGAGAACCCG
TGTATACCATAGAAGAAGCTGAAAGAGCTGCAGGGTTAGGGAAGGAGGGAAAACGACCGGTGAGAGAGGCTGTAT
TGGATGCCGAGATGAGTACTACGACTCCTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail