Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|096240
Gene name
Locationscaffold_6:2030262..2033120
Strand-
Gene length (bp)2858
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.8E-16 109 196

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 104 126 22
3 176 198 22
4 512 534 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|096240
MADSPRRVLSDSSESTLHPGLSPDFTSSEKRFRDTNDTIPNPEDLNGLKRRPKAYEPPSGHISLIILTPLFFIAV
GVALAIVTEISSRRGGFVVSTSPIQIFGTVSVQFLVSIIPVLIIFPAALLFREQDWLVRMYQPYVKLNQGGASAE
ETLLLDYLYQGPFFGLFSSLHYKHRIVFLSGLAACLTFAFQPLASAIGQIRQTPQTDRQDVISTEQIGLASNINS
LDGFSAAAGYIEAAAFHGLGDPPFVFNNWTTAEFIFPTEKKLNETLTINTTAVSTQPHCANSIEDVVPVPIPETT
SFSFSSLSIGRCTPTINVTFDAAAGNQQSGVVDVSCPDASQGIEKRPVMFWFLNTRTDVNPPKREVKTVFCAPTI
IPFTVTATAHLLDGRLDSCAKSGDFDHDNNVTGPPNNGEAFNALFFNTSSENTFVQERAKSIAARVSNAIFHLAI
LEPGGIQQAFDRPNRLLDLTAKIYTQHLSLSGKSIYFTKSQSTIPGERTSIVPRLWIDPLPSRILSICLVLVGLA
GLIVHIINYRQRRRLLLTTPPGTIASITALTVRSGFGNLLLPYDNTKELDKKLKGIRFRLDKRTGAIVADEVEEG
IPGIDLGRNEAFRVLLGHREDPFGQHGSSSQAAFQTAVGYPPWVTKTKRPSVY*
Coding >AgabiH97|096240
ATGGCAGATTCGCCAAGGCGTGTGCTGTCGGACTCTAGTGAATCAACTTTACATCCGGGCTTGTCACCCGACTTC
ACTTCCTCTGAAAAGCGTTTCCGTGATACCAATGACACCATACCCAATCCTGAAGACTTGAATGGCCTCAAACGT
CGCCCGAAAGCATATGAACCGCCCTCCGGACATATTTCCCTCATTATCCTTACGCCACTCTTCTTCATCGCGGTG
GGTGTCGCGTTGGCAATTGTAACAGAAATCTCAAGTAGACGAGGAGGTTTTGTAGTTTCAACATCGCCAATACAA
ATCTTTGGGACCGTGTCCGTGCAATTCCTTGTATCTATCATCCCAGTATTGATCATCTTTCCGGCTGCGCTCCTG
TTTCGGGAACAAGACTGGTTGGTCCGCATGTACCAGCCGTATGTCAAACTCAACCAAGGTGGTGCTTCGGCTGAA
GAGACATTGCTGCTCGACTATCTCTACCAAGGCCCCTTCTTTGGACTATTTTCCTCTCTCCATTATAAGCACAGG
ATCGTTTTCTTGTCAGGACTCGCAGCCTGTCTCACGTTCGCTTTTCAACCACTCGCGAGCGCTATCGGTCAAATA
AGACAAACGCCACAGACGGACAGGCAGGATGTCATCAGCACGGAACAAATAGGCCTGGCAAGCAATATCAATAGT
CTAGACGGATTTTCTGCTGCCGCGGGTTATATCGAAGCAGCCGCTTTCCATGGGTTGGGAGATCCCCCTTTTGTT
TTCAATAACTGGACTACCGCAGAATTCATTTTTCCTACGGAAAAGAAACTGAACGAAACTCTGACTATCAATACG
ACAGCGGTTTCTACTCAGCCTCATTGTGCCAATTCCATTGAAGACGTTGTGCCAGTTCCGATCCCAGAAACCACG
AGTTTCAGCTTCAGTTCGTTATCCATCGGACGGTGTACACCCACCATTAATGTGACGTTCGACGCGGCTGCGGGT
AATCAACAATCTGGCGTGGTCGATGTAAGTTGTCCTGACGCTTCACAAGGTATTGAAAAACGACCTGTCATGTTT
TGGTTTCTCAACACCCGGACGGACGTAAACCCGCCGAAACGGGAAGTCAAGACTGTCTTCTGTGCTCCCACCATC
ATTCCTTTTACTGTAACAGCAACTGCGCATCTGCTGGATGGAAGACTTGACAGTTGTGCTAAGTCTGGTGACTTC
GATCATGACAACAACGTGACCGGCCCACCTAATAACGGGGAAGCATTCAATGCTTTATTCTTTAATACTTCTTCT
GAGAACACCTTCGTTCAAGAAAGGGCAAAATCGATTGCTGCAAGAGTTTCAAATGCTATCTTCCACCTCGCTATC
CTAGAACCTGGAGGAATACAACAAGCGTTTGACCGTCCCAATAGATTGTTGGATTTGACGGCGAAAATCTACACT
CAGCACCTAAGTCTTTCCGGAAAATCAATCTATTTCACGAAAAGCCAATCTACAATTCCCGGTGAGAGAACATCT
ATTGTACCTAGGCTTTGGATCGATCCTCTTCCAAGTCGCATTCTCTCTATCTGTCTTGTTCTGGTTGGACTTGCT
GGGTTAATCGTTCATATAATCAATTATCGTCAACGAAGACGATTACTCCTCACCACTCCCCCCGGTACCATTGCC
TCAATCACAGCTTTGACTGTCCGATCCGGTTTTGGCAATCTGTTACTGCCTTACGATAATACCAAAGAACTGGAT
AAGAAGTTAAAAGGTATACGATTTCGGCTGGACAAGCGGACAGGGGCTATAGTTGCGGATGAAGTAGAGGAAGGG
ATTCCAGGAATAGATTTAGGTCGAAATGAAGCCTTCCGTGTGCTGTTAGGACACCGCGAGGATCCATTTGGTCAA
CATGGGTCTTCCTCTCAAGCGGCTTTTCAAACGGCGGTTGGATATCCGCCATGGGTGACAAAGACCAAACGCCCT
AGCGTTTATTAG
Transcript >AgabiH97|096240
ATGGCAGATTCGCCAAGGCGTGTGCTGTCGGACTCTAGTGAATCAACTTTACATCCGGGCTTGTCACCCGACTTC
ACTTCCTCTGAAAAGCGTTTCCGTGATACCAATGACACCATACCCAATCCTGAAGACTTGAATGGCCTCAAACGT
CGCCCGAAAGCATATGAACCGCCCTCCGGACATATTTCCCTCATTATCCTTACGCCACTCTTCTTCATCGCGGTG
GGTGTCGCGTTGGCAATTGTAACAGAAATCTCAAGTAGACGAGGAGGTTTTGTAGTTTCAACATCGCCAATACAA
ATCTTTGGGACCGTGTCCGTGCAATTCCTTGTATCTATCATCCCAGTATTGATCATCTTTCCGGCTGCGCTCCTG
TTTCGGGAACAAGACTGGTTGGTCCGCATGTACCAGCCGTATGTCAAACTCAACCAAGGTGGTGCTTCGGCTGAA
GAGACATTGCTGCTCGACTATCTCTACCAAGGCCCCTTCTTTGGACTATTTTCCTCTCTCCATTATAAGCACAGG
ATCGTTTTCTTGTCAGGACTCGCAGCCTGTCTCACGTTCGCTTTTCAACCACTCGCGAGCGCTATCGGTCAAATA
AGACAAACGCCACAGACGGACAGGCAGGATGTCATCAGCACGGAACAAATAGGCCTGGCAAGCAATATCAATAGT
CTAGACGGATTTTCTGCTGCCGCGGGTTATATCGAAGCAGCCGCTTTCCATGGGTTGGGAGATCCCCCTTTTGTT
TTCAATAACTGGACTACCGCAGAATTCATTTTTCCTACGGAAAAGAAACTGAACGAAACTCTGACTATCAATACG
ACAGCGGTTTCTACTCAGCCTCATTGTGCCAATTCCATTGAAGACGTTGTGCCAGTTCCGATCCCAGAAACCACG
AGTTTCAGCTTCAGTTCGTTATCCATCGGACGGTGTACACCCACCATTAATGTGACGTTCGACGCGGCTGCGGGT
AATCAACAATCTGGCGTGGTCGATGTAAGTTGTCCTGACGCTTCACAAGGTATTGAAAAACGACCTGTCATGTTT
TGGTTTCTCAACACCCGGACGGACGTAAACCCGCCGAAACGGGAAGTCAAGACTGTCTTCTGTGCTCCCACCATC
ATTCCTTTTACTGTAACAGCAACTGCGCATCTGCTGGATGGAAGACTTGACAGTTGTGCTAAGTCTGGTGACTTC
GATCATGACAACAACGTGACCGGCCCACCTAATAACGGGGAAGCATTCAATGCTTTATTCTTTAATACTTCTTCT
GAGAACACCTTCGTTCAAGAAAGGGCAAAATCGATTGCTGCAAGAGTTTCAAATGCTATCTTCCACCTCGCTATC
CTAGAACCTGGAGGAATACAACAAGCGTTTGACCGTCCCAATAGATTGTTGGATTTGACGGCGAAAATCTACACT
CAGCACCTAAGTCTTTCCGGAAAATCAATCTATTTCACGAAAAGCCAATCTACAATTCCCGGTGAGAGAACATCT
ATTGTACCTAGGCTTTGGATCGATCCTCTTCCAAGTCGCATTCTCTCTATCTGTCTTGTTCTGGTTGGACTTGCT
GGGTTAATCGTTCATATAATCAATTATCGTCAACGAAGACGATTACTCCTCACCACTCCCCCCGGTACCATTGCC
TCAATCACAGCTTTGACTGTCCGATCCGGTTTTGGCAATCTGTTACTGCCTTACGATAATACCAAAGAACTGGAT
AAGAAGTTAAAAGGTATACGATTTCGGCTGGACAAGCGGACAGGGGCTATAGTTGCGGATGAAGTAGAGGAAGGG
ATTCCAGGAATAGATTTAGGTCGAAATGAAGCCTTCCGTGTGCTGTTAGGACACCGCGAGGATCCATTTGGTCAA
CATGGGTCTTCCTCTCAAGCGGCTTTTCAAACGGCGGTTGGATATCCGCCATGGGTGACAAAGACCAAACGCCCT
AGCGTTTATTAG
Gene >AgabiH97|096240
ATGGCAGATTCGCCAAGGCGTGTGCTGTCGGACTCTAGTGAATCAACTTTACATCCGGGCTTGTCACCCGACTTC
ACTTCCTCTGAAAAGCGTTTCCGTGATACCAATGACACCATACCCAATCCTGAAGACTTGAATGGCCTCAAACGT
CGCCCGAAAGCATATGTATGTTCGTCCATACATCAATTAACATGTCATTGATTTCGTTGCGTGTCAGGAACCGCC
CTCCGGACATATTTCCCTCATTATCCTTACGCCACTCTTCTTCATCGCGGTGGGTGTCGCGTTGGCAATTGTAAC
AGAAATCTCAAGTAGACGAGGAGGTAAGATTTCTATTCAAAATCTTGACCATCCAACACTGACCGTACTTGACCA
ACAACAGGTTTTGTAGTTTCAACATCGCCAATACAAATCTTTGGGACCGTGTCCGTGCAATTCCTTGTAGTACGT
TTCCGGGTTTTGTTCATCGTCTATAACCTAATTCATCCAAATCTAGTCTATCATCCCAGTATTGTGAGTCTACCT
TTTCTGGTGCGCGAAATCTTCGGAACAACGAAGCGTTTCACCCGGCCTTTTATGTCACTACTCTTACGGAGAGCA
TACGGGCCTGGAGATATCACCAGTACGTAAATTCACACCTAATTTCTTCAAATTCAGGATCATCTTTCCGGCTGC
GCTCCTGTTTCGGGAACAAGACTGGTTGGTCCGCATGTACCAGGTATGATGAAGTTCTATCATATACCCATCGGT
GCTAACGTTCATATCTTGGCAGCCGTATGTCAAACTCAACCAAGGTGGTGCTTCGGCTGAAGAGACATTGCTGCT
CGACTATGTAAGTTATTCTAACATGATCCACCTAATGCGCTCTGATACCAAATGAGTTAAGCTCTACCAAGGGTG
AGGACAATACCTATTAATCGACAACTTATTGTTGACAGTAAAACCAGCCCCTTCTTTGGACTATTTTCCTCTCTC
CATTATAAGCACAGGATCGTTTTCTTGTCAGGACTCGCAGCCTGTCTCACGTTCGCTTTTCAACCACTCGGTGAG
AGAATGATTTACATATGGTTTTTTTTTTTTGGCTAATGCTCGGCTTCAGCGAGCGCTATCGGTCAAATAAGACAA
ACGCCACAGACGGACAGTAAGCCCACCTGAATCATTTCCATTGATTCGCATTTCAGCTTTTAATCTAGGGCAGGA
TGTCATCAGCACGGAACAAATAGGCCTGGCAAGCAATATCAATAGTCTAGACGGATTTTCTGCTGCCGCGGGTTA
TATCGAAGCAGCCGCTTTCCATGGGTTGGGAGATCCCCCTTTTGTTTTCAATAACTGGACTACCGCAGAATTCAT
TGTAAGTAATTGCTGTCGCATTACTCGATTACCATCTTACACGTTAACGTTCATAGTTTCCTACGGAAAAGAAAC
TGAACGAAACTCTGACTATCAATACGACAGCGGTTTCTACTCAGCCTCATTGTGCCAATTCCATTGAAGACGTTG
TGCCAGTTCCGATCCCAGAAACCACGAGTTTCAGCTTCAGTTCGTTATCCATCGGACGGTGTACACCCACCATTA
ATGTGACGTTCGACGCGGCTGTGAGTTTTTGCACATCGAGAAACTTTTTGCTCTAGCTGACGGACGATTATAGGC
GGGTAATCAACAATCTGGCGTGGTCGATGTAAGTTGTCCTGACGCTTCACAAGGTATTGAAAAACGACCTGTCAT
GTTTTGGTGCGCTCTCTTTTTTTCTCATAAAATTTCCATTATTTAGAGTCAAAGCTCAGGTTTCTCAACACCCGG
ACGGACGTAAACCCGCCGAAACGGGAAGTCAAGACTGTCTTCTGTGCTCCCACCATCATTCCTTTTACTGTAACA
GCAACTGCGCATCTGCTGGATGGAAGACTTGACAGTTGTGCTAAGTCTGGTGACTTCGATCATGACAACAACGTG
ACCGGCCCACCTAATAACGGGGAAGCATTCAATGCGTGAGAATATTTTACCTCTAATTTTATTTCATGGATTTAT
CTCTGCATTCAGTTTATTCTTTAATACTTCTTCTGAGAACACCTTCGTTCAAGAAAGGGCAAAATCGATTGCTGC
AAGAGTTTCAAATGCTATCTTCCACCTCGCTATCCTAGAACCTGGAGGAATACAACAAGCGTTTGACCGTCCCAA
TAGATTGTTGGATTTGACGGCGAAAATCTACGTCAGTGGACACGCTTCAACTTGCTCAGCGTCACTCACCCTATC
CTTGTCAGACTCAGCACCTAAGTCTTTCCGGAAAATCAATCTATTTCACGAAAAGCCAATCTACAATTCCCGGTG
AGAGAACATCTATTGTACCTAGGCTTTGGATCGAGTGAGTAATTCTTTTTTTTTACACTAATATCAAACCTAAAT
GCGTCTTACTATCATACAGTCCTCTTCCAAGTCGCATTCTCTCTATCTGTCTTGTTCTGGTTGGACTTGCTGGGT
TAATCGTTCATATAATCAATTATCGTCAACGAAGACGATTACTCCTCACCACTCCCCCCGGTACCATTGCCTCAA
TCACAGCTTTGACTGTCCGATCCGGTTTTGGCAATCTGTTACTGCCTTACGATAATACCAAAGAACTGGATAAGA
AGTTAAAAGGTATACGATTTCGGCTGGACAAGCGGACAGGGGCTATAGTTGCGGATGAAGTAGAGGAAGGGATTC
CAGGAATAGATTTAGGTCGAAATGAAGCCTTCCGTGTGCTGTTAGGACACCGCGAGGATCCATTTGGTCAACATG
GGTCTTCCTCTCAAGCGGCTTTTCAAACGGCGGTTGGATATCCGCCATGGGTGACAAAGACCAAACGCCCTAGCG
TTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail