Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|095800
Gene name
Locationscaffold_6:1930369..1931881
Strand-
Gene length (bp)1512
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 2.8E-06 55 115

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.62 0.5783 0.0944 0.0668 0.2252 0.0064 0.068 0.1526 0.1012 0.007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 17.58 8.79 26.36
Initials Initials knots 26.77 15.22 38.32
Pileal_Stipeal_center Stage I stipe center 7.02 3.20 10.84
Pileal_Stipeal_shell Stage I stipe shell 5.33 2.39 8.27
DIF_stipe_center Stage II stipe center 4.65 2.07 7.23
DIF_stipe_shell Stage II stipe shell 9.03 4.46 13.61
DIF_stipe_skin Stage II stipe skin 9.09 4.50 13.68
DIF_cap_skin Stage II cap skin 4.79 2.11 7.46
DIF_cap_tissue Stage II cap tissue 3.19 1.25 5.13
DIF_gill_tissue Stage II gill tissue 2.08 0.74 3.42
YFB_stipe_center Young fruiting body stipe center 7.90 3.65 12.16
YFB_stipe_shell Young fruiting body stipe shell 10.78 5.41 16.16
YFB_stipe_skin Young fruiting body stipe skin 12.62 6.52 18.72
YFB_cap_skin Young fruiting body cap skin 7.98 3.88 12.09
YFB_cap_tissue Young fruiting body cap tissue 3.65 1.47 5.82
YFB_gill_tissue Young fruiting body gill tissue 7.87 3.47 12.28
YFB_veil Young fruiting body veil 5.55 2.49 8.61

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.009123 yes
Casing YFB_stipe_shell 0.177188 no
Casing YFB_stipe_skin 0.405504 no
Casing YFB_cap_skin 0.013782 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.014081 yes
Casing YFB_veil 0.001140 yes
Casing Initials 0.212151 no
Casing Pileal_Stipeal_center 0.006387 yes
Casing Pileal_Stipeal_shell 0.001140 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.038720 yes
Casing DIF_stipe_skin 0.041386 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.233970 no
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.011041 yes
YFB_stipe_center YFB_stipe_shell 0.485218 no
YFB_stipe_center YFB_stipe_skin 0.204111 no
YFB_stipe_center YFB_cap_skin 0.987595 no
YFB_stipe_center YFB_cap_tissue 0.042692 yes
YFB_stipe_center YFB_gill_tissue 0.995145 no
YFB_stipe_center YFB_veil 0.427784 no
YFB_stipe_shell YFB_stipe_skin 0.768928 no
YFB_stipe_shell YFB_cap_skin 0.502622 no
YFB_stipe_shell YFB_cap_tissue 0.001140 yes
YFB_stipe_shell YFB_gill_tissue 0.483821 no
YFB_stipe_shell YFB_veil 0.069952 no
YFB_stipe_skin YFB_cap_skin 0.225927 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.213655 no
YFB_stipe_skin YFB_veil 0.017783 yes
YFB_cap_skin YFB_cap_tissue 0.043339 yes
YFB_cap_skin YFB_gill_tissue 0.984672 no
YFB_cap_skin YFB_veil 0.414334 no
YFB_cap_tissue YFB_gill_tissue 0.050706 no
YFB_cap_tissue YFB_veil 0.377348 no
YFB_gill_tissue YFB_veil 0.448703 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.004548 yes
Initials YFB_stipe_skin 0.012880 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.846805 no
Pileal_Stipeal_center YFB_stipe_shell 0.298330 no
Pileal_Stipeal_center YFB_stipe_skin 0.106969 no
Pileal_Stipeal_center YFB_cap_skin 0.830769 no
Pileal_Stipeal_center YFB_cap_tissue 0.117324 no
Pileal_Stipeal_center YFB_gill_tissue 0.856612 no
Pileal_Stipeal_center YFB_veil 0.665461 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.581299 no
Pileal_Stipeal_center DIF_stipe_center 0.346529 no
Pileal_Stipeal_center DIF_stipe_shell 0.601639 no
Pileal_Stipeal_center DIF_stipe_skin 0.593450 no
Pileal_Stipeal_center DIF_cap_skin 0.388159 no
Pileal_Stipeal_center DIF_cap_tissue 0.038047 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.016386 yes
Pileal_Stipeal_shell YFB_stipe_center 0.351492 no
Pileal_Stipeal_shell YFB_stipe_shell 0.050294 no
Pileal_Stipeal_shell YFB_stipe_skin 0.013186 yes
Pileal_Stipeal_shell YFB_cap_skin 0.342737 no
Pileal_Stipeal_shell YFB_cap_tissue 0.443780 no
Pileal_Stipeal_shell YFB_gill_tissue 0.370918 no
Pileal_Stipeal_shell YFB_veil 0.957210 no
Pileal_Stipeal_shell DIF_stipe_center 0.828053 no
Pileal_Stipeal_shell DIF_stipe_shell 0.157706 no
Pileal_Stipeal_shell DIF_stipe_skin 0.156118 no
Pileal_Stipeal_shell DIF_cap_skin 0.870742 no
Pileal_Stipeal_shell DIF_cap_tissue 0.230438 no
DIF_stipe_center DIF_gill_tissue 0.042909 yes
DIF_stipe_center YFB_stipe_center 0.160907 no
DIF_stipe_center YFB_stipe_shell 0.016949 yes
DIF_stipe_center YFB_stipe_skin 0.002084 yes
DIF_stipe_center YFB_cap_skin 0.165674 no
DIF_stipe_center YFB_cap_tissue 0.675756 no
DIF_stipe_center YFB_gill_tissue 0.183436 no
DIF_stipe_center YFB_veil 0.770222 no
DIF_stipe_center DIF_stipe_shell 0.061844 no
DIF_stipe_center DIF_stipe_skin 0.061086 no
DIF_stipe_center DIF_cap_skin 0.968938 no
DIF_stipe_center DIF_cap_tissue 0.431106 no
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.814860 no
DIF_stipe_shell YFB_stipe_shell 0.740948 no
DIF_stipe_shell YFB_stipe_skin 0.409533 no
DIF_stipe_shell YFB_cap_skin 0.833543 no
DIF_stipe_shell YFB_cap_tissue 0.016386 yes
DIF_stipe_shell YFB_gill_tissue 0.814516 no
DIF_stipe_shell YFB_veil 0.209844 no
DIF_stipe_shell DIF_stipe_skin 0.991727 no
DIF_stipe_shell DIF_cap_skin 0.079829 no
DIF_stipe_shell DIF_cap_tissue 0.004160 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.804711 no
DIF_stipe_skin YFB_stipe_shell 0.752354 no
DIF_stipe_skin YFB_stipe_skin 0.424204 no
DIF_stipe_skin YFB_cap_skin 0.823270 no
DIF_stipe_skin YFB_cap_tissue 0.015242 yes
DIF_stipe_skin YFB_gill_tissue 0.804175 no
DIF_stipe_skin YFB_veil 0.200916 no
DIF_stipe_skin DIF_cap_skin 0.070499 no
DIF_stipe_skin DIF_cap_tissue 0.003765 yes
DIF_cap_skin DIF_gill_tissue 0.037140 yes
DIF_cap_skin YFB_stipe_center 0.184076 no
DIF_cap_skin YFB_stipe_shell 0.022369 yes
DIF_cap_skin YFB_stipe_skin 0.004548 yes
DIF_cap_skin YFB_cap_skin 0.189640 no
DIF_cap_skin YFB_cap_tissue 0.618321 no
DIF_cap_skin YFB_gill_tissue 0.210655 no
DIF_cap_skin YFB_veil 0.810507 no
DIF_cap_skin DIF_cap_tissue 0.379450 no
DIF_cap_tissue DIF_gill_tissue 0.395587 no
DIF_cap_tissue YFB_stipe_center 0.011041 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.010412 yes
DIF_cap_tissue YFB_cap_tissue 0.851498 no
DIF_cap_tissue YFB_gill_tissue 0.012880 yes
DIF_cap_tissue YFB_veil 0.188160 no

Orthologs

Orthofinder run ID1
Orthogroup12839
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|095800
Agaricus bisporus var bisporus H97 AgabiH97|095800 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|095800
MMLSNLSRTPLSAVTHDQSTEMIIPSSKYSSPSETVRIRPLERLHILNFTQSKTRSLPSELLSIIFQYACPTPPD
IFGEKRIPTMAPFHLILRLVSTLWYDISQSTPQLWASIFLPKLRAENVDIRARYLKLCLDNSGNIPLTVFLGFEE
ESWNIGWFISPIVDAALERSAHRIQALRILRPPGDWLEKLIPKMCQLATIHIDNPRPNLPWSPDQRVERLLLPRS
SNMNRIYIRCPCLFDLRSAPTAQSITHVEIFELPVDFVMEFLSRCPNLVAFHCRYPIAPSQVKNPHTMLTSPFVL
RHLSTFTWSTTRILDRISEWDITLFEHIHFPALTRFNWWPGLCFYVDDTALALPIFRFPTSVTTLQFGGVGYRPV
ETFYLIHFFPFTGVTQLRLLHCEYRFVDQVLSFLSRGTERSNTLFPQLTSIMIDYRVAGVVTPRCERFYPESGKK
LVQMLRSRIGLIDEFTLIVEIARFTQHWNDEVWEAVRQVKRDGINLTSKMDVL*
Coding >AgabiH97|095800
ATGATGCTATCTAATCTATCTCGTACTCCTTTGAGTGCCGTCACTCATGATCAGTCTACTGAGATGATCATACCA
TCGAGCAAGTACTCTTCTCCTTCTGAGACAGTCAGAATTCGCCCTTTAGAGAGGCTCCATATTCTCAATTTCACT
CAATCTAAGACTCGATCGTTGCCCTCCGAATTGTTGTCCATCATCTTCCAGTATGCCTGCCCGACTCCTCCCGAT
ATTTTCGGCGAGAAACGCATCCCGACAATGGCACCCTTCCATCTCATCTTGCGCTTGGTATCGACGTTATGGTAC
GACATATCACAGTCAACACCTCAGCTGTGGGCCTCCATCTTCTTGCCGAAATTACGTGCAGAGAATGTTGATATC
AGGGCACGATATCTAAAGCTTTGTCTAGATAATTCCGGCAACATACCCCTCACCGTATTTCTTGGATTTGAAGAA
GAGTCATGGAACATCGGCTGGTTTATTTCTCCCATAGTCGATGCCGCTTTGGAGCGTAGTGCGCATCGCATCCAA
GCTCTTCGAATACTTCGACCTCCTGGTGACTGGTTGGAGAAACTAATTCCAAAAATGTGCCAACTTGCTACAATA
CACATTGACAATCCTCGACCAAATCTACCCTGGTCGCCCGATCAACGTGTGGAGCGCCTTCTCCTTCCGAGGAGC
AGCAATATGAATCGAATTTACATTCGATGCCCTTGCCTTTTTGACCTCCGATCTGCGCCTACAGCACAATCGATT
ACCCACGTGGAGATATTTGAACTGCCTGTCGACTTCGTCATGGAATTTCTTTCGAGATGCCCTAATTTGGTTGCC
TTCCACTGTCGATATCCAATCGCTCCGTCCCAAGTCAAAAATCCTCATACTATGCTTACATCTCCCTTCGTACTC
CGCCATCTTTCTACGTTTACCTGGTCCACCACTCGAATCCTCGACCGCATTTCCGAGTGGGATATTACACTATTT
GAGCACATTCATTTTCCAGCCCTAACGAGGTTCAATTGGTGGCCTGGTCTGTGTTTCTATGTAGATGACACTGCA
CTTGCGTTGCCGATATTCCGATTTCCGACATCGGTCACTACTCTCCAATTTGGTGGAGTCGGTTACCGCCCAGTA
GAAACCTTTTACTTGATTCATTTTTTCCCGTTCACTGGTGTCACTCAACTTCGGCTTTTACATTGTGAATATCGT
TTTGTGGATCAAGTCTTGTCTTTCCTCTCAAGAGGGACAGAGCGAAGTAATACCTTATTCCCTCAACTCACGTCC
ATCATGATCGATTACCGGGTGGCGGGGGTGGTGACACCACGGTGTGAGAGGTTTTATCCAGAAAGCGGGAAGAAA
CTAGTGCAGATGTTACGAAGCAGGATTGGTTTGATAGACGAATTTACACTAATAGTGGAAATAGCTCGCTTCACA
CAACACTGGAATGATGAAGTATGGGAAGCTGTAAGGCAAGTCAAACGAGATGGAATCAATCTAACATCGAAGATG
GATGTCCTATAA
Transcript >AgabiH97|095800
ATGATGCTATCTAATCTATCTCGTACTCCTTTGAGTGCCGTCACTCATGATCAGTCTACTGAGATGATCATACCA
TCGAGCAAGTACTCTTCTCCTTCTGAGACAGTCAGAATTCGCCCTTTAGAGAGGCTCCATATTCTCAATTTCACT
CAATCTAAGACTCGATCGTTGCCCTCCGAATTGTTGTCCATCATCTTCCAGTATGCCTGCCCGACTCCTCCCGAT
ATTTTCGGCGAGAAACGCATCCCGACAATGGCACCCTTCCATCTCATCTTGCGCTTGGTATCGACGTTATGGTAC
GACATATCACAGTCAACACCTCAGCTGTGGGCCTCCATCTTCTTGCCGAAATTACGTGCAGAGAATGTTGATATC
AGGGCACGATATCTAAAGCTTTGTCTAGATAATTCCGGCAACATACCCCTCACCGTATTTCTTGGATTTGAAGAA
GAGTCATGGAACATCGGCTGGTTTATTTCTCCCATAGTCGATGCCGCTTTGGAGCGTAGTGCGCATCGCATCCAA
GCTCTTCGAATACTTCGACCTCCTGGTGACTGGTTGGAGAAACTAATTCCAAAAATGTGCCAACTTGCTACAATA
CACATTGACAATCCTCGACCAAATCTACCCTGGTCGCCCGATCAACGTGTGGAGCGCCTTCTCCTTCCGAGGAGC
AGCAATATGAATCGAATTTACATTCGATGCCCTTGCCTTTTTGACCTCCGATCTGCGCCTACAGCACAATCGATT
ACCCACGTGGAGATATTTGAACTGCCTGTCGACTTCGTCATGGAATTTCTTTCGAGATGCCCTAATTTGGTTGCC
TTCCACTGTCGATATCCAATCGCTCCGTCCCAAGTCAAAAATCCTCATACTATGCTTACATCTCCCTTCGTACTC
CGCCATCTTTCTACGTTTACCTGGTCCACCACTCGAATCCTCGACCGCATTTCCGAGTGGGATATTACACTATTT
GAGCACATTCATTTTCCAGCCCTAACGAGGTTCAATTGGTGGCCTGGTCTGTGTTTCTATGTAGATGACACTGCA
CTTGCGTTGCCGATATTCCGATTTCCGACATCGGTCACTACTCTCCAATTTGGTGGAGTCGGTTACCGCCCAGTA
GAAACCTTTTACTTGATTCATTTTTTCCCGTTCACTGGTGTCACTCAACTTCGGCTTTTACATTGTGAATATCGT
TTTGTGGATCAAGTCTTGTCTTTCCTCTCAAGAGGGACAGAGCGAAGTAATACCTTATTCCCTCAACTCACGTCC
ATCATGATCGATTACCGGGTGGCGGGGGTGGTGACACCACGGTGTGAGAGGTTTTATCCAGAAAGCGGGAAGAAA
CTAGTGCAGATGTTACGAAGCAGGATTGGTTTGATAGACGAATTTACACTAATAGTGGAAATAGCTCGCTTCACA
CAACACTGGAATGATGAAGTATGGGAAGCTGTAAGGCAAGTCAAACGAGATGGAATCAATCTAACATCGAAGATG
GATGTCCTATAA
Gene >AgabiH97|095800
ATGATGCTATCTAATCTATCTCGTACTCCTTTGAGTGCCGTCACTCATGATCAGTCTACTGAGATGATCATACCA
TCGAGCAAGTACTCTTCTCCTTCTGAGACAGTCAGAATTCGCCCTTTAGAGAGGCTCCATATTCTCAATTTCACT
CAATCTAAGACTCGATCGTTGCCCTCCGAATTGTTGTCCATCATCTTCCAGTATGCCTGCCCGACTCCTCCCGAT
ATTTTCGGCGAGAAACGCATCCCGACAATGGCACCCTTCCATCTCATCTTGCGCTTGGTATCGACGTTATGGTAC
GACATATCACAGTCAACACCTCAGCTGTGGGCCTCCATCTTCTTGCCGAAATTACGTGCAGAGAATGTTGATATC
AGGGCACGATATCTAAAGCTTTGTCTAGATAATTCCGGCAACATACCCCTCACCGTATTTCTTGGATTTGAAGAA
GAGTCATGGAACATCGGCTGGTTTATTTCTCCCATAGTCGATGCCGCTTTGGAGCGTAGTGCGCATCGCATCCAA
GCTCTTCGAATACTTCGACCTCCTGGTGACTGGTTGGAGAAACTAATTCCAAAAATGTGCCAACTTGCTACAATA
CACATTGACAATCCTCGACCAAATCTACCCTGGTCGCCCGATCAACGTGTGGAGCGCCTTCTCCTTCCGAGGAGC
AGCAATATGAATCGAATTTACATTCGATGCCCTTGCCTTTTTGACCTCCGATCTGCGCCTACAGCACAATCGATT
ACCCACGTGGAGATATTTGAACTGCCTGTCGACTTCGTCATGGAATTTCTTTCGAGATGCCCTAATTTGGTTGCC
TTCCACTGTCGATATCCAATCGCTCCGTCCCAAGTCAAAAATCCTCATACTATGCTTACATCTCCCTTCGTACTC
CGCCATCTTTCTACGTTTACCTGGTCCACCACTCGAATCCTCGACCGCATTTCCGAGTGGGATATTACACTATTT
GAGCACATTCATTTTCCAGCCCTAACGAGGTTCAATTGGTGGCCTGGTCTGTGTTTCTATGTAGATGACACTGCA
CTTGCGTTGCCGATATTCCGATTTCCGACATCGGTCACTACTCTCCAATTTGGTGGAGTCGGTTACCGCCCAGTA
GAAACCTTTTACTTGATTCATTTTTTCCCGTTCACTGGTGTCACTCAACTTCGGCTTTTACATTGTGAATATCGT
TTTGTGGATCAAGTCTTGTCTTTCCTCTCAAGAGGGACAGAGCGAAGTAATACCTTATTCCCTCAACTCACGTCC
ATCATGATCGATTACCGGGTGGCGGGGGTGGTGACACCACGGTGTGAGAGGTTTTATCCAGAAAGCGGGAAGAAA
CTAGTGCAGATGTTACGAAGCAGGATTGGTTTGATAGACGAATTTACACTAATAGTGGAAATAGCTCGCTTCACA
CAACACTGGAATGATGAAGTATGGGAAGCTGTAAGGCAAGTCAAACGAGATGGAATCAATCTAACATCGAAGATG
GATGTCCTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail