Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|095530
Gene name
Locationscaffold_6:1871092..1871731
Strand-
Gene length (bp)639
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05180 zf-DNL DNL zinc finger 1.1E-30 106 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09759|YA72_SCHPO Uncharacterized protein C24H6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.02c PE=3 SV=1 101 179 1.0E-20
sp|Q5SXM8|DNLZ_HUMAN DNL-type zinc finger protein OS=Homo sapiens GN=DNLZ PE=1 SV=1 96 189 8.0E-20
sp|Q9D113|DNLZ_MOUSE DNL-type zinc finger protein OS=Mus musculus GN=Dnlz PE=1 SV=1 84 189 3.0E-19
sp|A1L1P7|DNLZ_DANRE DNL-type zinc finger protein OS=Danio rerio GN=dnlz PE=2 SV=1 95 178 5.0E-18
sp|Q0IH40|DNLZ_XENLA DNL-type zinc finger protein OS=Xenopus laevis GN=dnlz PE=2 SV=1 106 178 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09759|YA72_SCHPO Uncharacterized protein C24H6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.02c PE=3 SV=1 101 179 1.0E-20
sp|Q5SXM8|DNLZ_HUMAN DNL-type zinc finger protein OS=Homo sapiens GN=DNLZ PE=1 SV=1 96 189 8.0E-20
sp|Q9D113|DNLZ_MOUSE DNL-type zinc finger protein OS=Mus musculus GN=Dnlz PE=1 SV=1 84 189 3.0E-19
sp|A1L1P7|DNLZ_DANRE DNL-type zinc finger protein OS=Danio rerio GN=dnlz PE=2 SV=1 95 178 5.0E-18
sp|Q0IH40|DNLZ_XENLA DNL-type zinc finger protein OS=Xenopus laevis GN=dnlz PE=2 SV=1 106 178 7.0E-18
sp|P42844|ZIM17_YEAST Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZIM17 PE=1 SV=2 101 176 1.0E-17
sp|A6ZSH0|ZIM17_YEAS7 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain YJM789) GN=ZIM17 PE=3 SV=2 101 176 1.0E-17
sp|B5VQB0|ZIM17_YEAS6 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ZIM17 PE=3 SV=2 101 176 1.0E-17
sp|B3LPE4|ZIM17_YEAS1 Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ZIM17 PE=3 SV=2 101 176 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|095530
MLPSRLFRNTGLPPALRSLLIPSPSLPSTYNVQLRFRLGIAVPAVAAPQSSRYSTASSSSSSPPSSSSSNNTLNL
GNEEKTPTQETEETPVVGRQAVGKMEPKLSITFTCTVEGCGKRSSHEFSKHAYEKGIVLVQCPGCKNRHLIADHL
GWFKDSTEDGKLRTIEDLLKSKGEVVKRGKVDPNGTIELAY*
Coding >AgabiH97|095530
ATGCTTCCTTCACGACTTTTCCGTAACACAGGTCTACCACCAGCACTTCGCAGTCTCCTCATTCCAAGTCCATCA
CTTCCATCGACTTATAATGTTCAACTCCGTTTTCGTTTGGGTATAGCCGTTCCTGCAGTCGCTGCTCCTCAATCT
TCACGTTATTCTACCGCTTCTTCATCTTCATCGTCACCTCCTTCGTCATCATCATCTAATAACACGTTGAACCTC
GGCAATGAAGAAAAGACACCCACACAAGAAACAGAAGAAACACCTGTCGTCGGCAGACAAGCTGTGGGTAAAATG
GAACCCAAGCTCTCAATAACATTCACTTGTACCGTTGAAGGATGTGGTAAAAGATCATCGCACGAATTCTCAAAA
CATGCATATGAGAAAGGAATTGTACTAGTACAATGTCCTGGTTGCAAAAACCGGCATCTCATAGCGGATCATTTG
GGCTGGTTCAAAGATTCAACGGAGGACGGTAAACTACGAACGATTGAGGATTTATTGAAATCTAAAGGCGAAGTG
GTGAAACGAGGAAAGGTGGATCCTAACGGTACAATCGAATTGGCCTACTAG
Transcript >AgabiH97|095530
ATGCTTCCTTCACGACTTTTCCGTAACACAGGTCTACCACCAGCACTTCGCAGTCTCCTCATTCCAAGTCCATCA
CTTCCATCGACTTATAATGTTCAACTCCGTTTTCGTTTGGGTATAGCCGTTCCTGCAGTCGCTGCTCCTCAATCT
TCACGTTATTCTACCGCTTCTTCATCTTCATCGTCACCTCCTTCGTCATCATCATCTAATAACACGTTGAACCTC
GGCAATGAAGAAAAGACACCCACACAAGAAACAGAAGAAACACCTGTCGTCGGCAGACAAGCTGTGGGTAAAATG
GAACCCAAGCTCTCAATAACATTCACTTGTACCGTTGAAGGATGTGGTAAAAGATCATCGCACGAATTCTCAAAA
CATGCATATGAGAAAGGAATTGTACTAGTACAATGTCCTGGTTGCAAAAACCGGCATCTCATAGCGGATCATTTG
GGCTGGTTCAAAGATTCAACGGAGGACGGTAAACTACGAACGATTGAGGATTTATTGAAATCTAAAGGCGAAGTG
GTGAAACGAGGAAAGGTGGATCCTAACGGTACAATCGAATTGGCCTACTAG
Gene >AgabiH97|095530
ATGCTTCCTTCACGACTTTTCCGTAACACAGGTCTACCACCAGCACTTCGCAGTCTCCTCATTCCAAGTCCATCA
CTTCCATCGACTTATAATGTTCAACTCCGTTTTCGTTTGGGTATAGCCGTTCCTGCAGTCGCTGCTCCTCAATCT
TCACGTTATTCTACCGCTTCTTCATCTTCATCGTCACCTCCTTCGTCATCATCATCTAATAACACGTTGAACCTC
GGCAATGAAGAAAAGACACCCACACAAGAAACAGAAGAAACACCTGTCGTCGGCAGACAAGCTGTGGGTAAAATG
GAACCCAAGCTCTCAATAACATTCACTTGTACCGTTGAAGGATGTGGTAAAAGATCATCGCACGAATTCTCAAAA
CATGCATATGAGAAAGGAATTGTACTAGTACAATGTCCTGGTTGCAAAAACCGGTACGTCAATTTTTTTCGTCCA
AAGTCTAATTAAGCTAATTTCATTATTCATGATACCTATAGGCATCTCATAGCGGATCATTTGGGCTGGTTCAAA
GATTCAACGGAGGACGGTAAACTACGAACGATTGAGGATTTATTGAAATCTAAAGGCGAAGTGGTGAAACGAGGA
AAGGTGGATCCTAACGGTACAATCGAATTGGCCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail