Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|095220
Gene name
Locationscaffold_6:1792836..1793623
Strand+
Gene length (bp)787
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 2.4E-49 15 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 3 208 1.0E-49
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 3 208 1.0E-48
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 10 208 1.0E-48
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 9 208 1.0E-47
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 13 208 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 3 208 1.0E-49
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 3 208 1.0E-48
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 10 208 1.0E-48
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 9 208 1.0E-47
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 13 208 1.0E-46
sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus GN=Tmed9 PE=1 SV=2 13 208 1.0E-46
sp|Q9I7K5|TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster GN=eca PE=2 SV=2 1 208 3.0E-45
sp|B3NZM5|TMEDE_DROER Transmembrane emp24 domain-containing protein eca OS=Drosophila erecta GN=eca PE=3 SV=1 1 208 1.0E-44
sp|B4HJV5|TMEDE_DROSE Transmembrane emp24 domain-containing protein eca OS=Drosophila sechellia GN=eca PE=3 SV=1 1 208 1.0E-44
sp|B4PVC6|TMEDE_DROYA Transmembrane emp24 domain-containing protein eca OS=Drosophila yakuba GN=eca PE=3 SV=1 1 208 1.0E-44
sp|B4QWH9|TMEDE_DROSI Transmembrane emp24 domain-containing protein eca OS=Drosophila simulans GN=eca PE=3 SV=1 1 208 2.0E-44
sp|B4JG34|TMEDE_DROGR Transmembrane emp24 domain-containing protein eca OS=Drosophila grimshawi GN=eca PE=3 SV=1 3 208 1.0E-43
sp|B3MTS8|TMEDE_DROAN Transmembrane emp24 domain-containing protein eca OS=Drosophila ananassae GN=eca PE=3 SV=1 12 208 2.0E-43
sp|B4NKL0|TMEDE_DROWI Transmembrane emp24 domain-containing protein eca OS=Drosophila willistoni GN=eca PE=3 SV=1 5 208 2.0E-43
sp|B4KB41|TMEDE_DROMO Transmembrane emp24 domain-containing protein eca OS=Drosophila mojavensis GN=eca PE=3 SV=1 3 208 2.0E-43
sp|B4LYB8|TMEDE_DROVI Transmembrane emp24 domain-containing protein eca OS=Drosophila virilis GN=eca PE=3 SV=1 3 208 2.0E-43
sp|B4GMC3|TMEDE_DROPE Transmembrane emp24 domain-containing protein eca OS=Drosophila persimilis GN=eca PE=3 SV=1 12 208 3.0E-43
sp|Q295B2|TMEDE_DROPS Transmembrane emp24 domain-containing protein eca OS=Drosophila pseudoobscura pseudoobscura GN=eca PE=3 SV=1 12 208 4.0E-43
sp|P53198|ERP6_YEAST Protein ERP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP6 PE=1 SV=1 2 208 3.0E-42
sp|P27869|TMD11_CANLF Transmembrane emp24 domain-containing protein 11 OS=Canis lupus familiaris GN=TMED11 PE=1 SV=1 3 208 5.0E-41
sp|O14324|YB79_SCHPO Uncharacterized membrane protein C16E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.09c PE=3 SV=1 13 208 6.0E-39
sp|Q9D2R4|TMD11_MOUSE Transmembrane emp24 domain-containing protein 11 OS=Mus musculus GN=Tmed11 PE=1 SV=1 3 208 8.0E-39
sp|Q05359|ERP1_YEAST Protein ERP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP1 PE=1 SV=1 7 208 9.0E-38
sp|P38819|ERP5_YEAST Protein ERP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP5 PE=1 SV=1 3 208 2.0E-29
sp|A0AQ71|TMEDA_DROSI Transmembrane emp24 domain-containing protein bai OS=Drosophila simulans GN=bai PE=3 SV=1 3 208 4.0E-18
sp|B4PUZ3|TMEDA_DROYA Transmembrane emp24 domain-containing protein bai OS=Drosophila yakuba GN=bai PE=3 SV=1 5 208 6.0E-18
sp|B3P6T8|TMEDA_DROER Transmembrane emp24 domain-containing protein bai OS=Drosophila erecta GN=bai PE=3 SV=1 5 208 6.0E-18
sp|Q90515|TMEDA_TAKRU Transmembrane emp24 domain-containing protein 10 OS=Takifugu rubripes GN=tmed10 PE=3 SV=1 3 208 6.0E-18
sp|B3LVB0|TMEDA_DROAN Transmembrane emp24 domain-containing protein bai OS=Drosophila ananassae GN=bai PE=3 SV=1 3 208 1.0E-17
sp|Q8SXY6|TMEDA_DROME Transmembrane emp24 domain-containing protein bai OS=Drosophila melanogaster GN=bai PE=2 SV=1 5 208 1.0E-17
sp|Q9D1D4|TMEDA_MOUSE Transmembrane emp24 domain-containing protein 10 OS=Mus musculus GN=Tmed10 PE=1 SV=1 3 208 1.0E-16
sp|O35587|TMEDA_MESAU Transmembrane protein Tmp21 OS=Mesocricetus auratus GN=TMED10 PE=1 SV=1 12 208 2.0E-16
sp|Q28735|TMEDA_RABIT Transmembrane emp24 domain-containing protein 10 OS=Oryctolagus cuniculus GN=TMED10 PE=1 SV=1 12 208 2.0E-16
sp|Q5E971|TMEDA_BOVIN Transmembrane emp24 domain-containing protein 10 OS=Bos taurus GN=TMED10 PE=2 SV=1 12 208 3.0E-16
sp|B4JYU5|TMEDA_DROGR Transmembrane emp24 domain-containing protein bai OS=Drosophila grimshawi GN=bai PE=3 SV=2 1 208 7.0E-16
sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens GN=TMED10 PE=1 SV=2 15 208 7.0E-16
sp|Q63584|TMEDA_RAT Transmembrane emp24 domain-containing protein 10 OS=Rattus norvegicus GN=Tmed10 PE=1 SV=2 12 208 8.0E-16
sp|B4K4G5|TMEDA_DROMO Transmembrane emp24 domain-containing protein bai OS=Drosophila mojavensis GN=bai PE=3 SV=1 1 208 1.0E-15
sp|B4GE47|TMEDA_DROPE Transmembrane emp24 domain-containing protein bai OS=Drosophila persimilis GN=bai PE=3 SV=1 2 208 1.0E-15
sp|Q5RE32|TMEDA_PONAB Transmembrane emp24 domain-containing protein 10 OS=Pongo abelii GN=TMED10 PE=2 SV=1 15 208 2.0E-15
sp|Q8RWM6|P24D5_ARATH Transmembrane emp24 domain-containing protein p24delta5 OS=Arabidopsis thaliana GN=At1g21900 PE=1 SV=1 26 208 2.0E-15
sp|B4MGF8|TMEDA_DROVI Transmembrane emp24 domain-containing protein bai OS=Drosophila virilis GN=bai PE=3 SV=1 1 208 2.0E-15
sp|Q8VY92|P24DA_ARATH Transmembrane emp24 domain-containing protein p24delta10 OS=Arabidopsis thaliana GN=At1g69460 PE=1 SV=1 3 208 2.0E-15
sp|Q6IDL4|P24D3_ARATH Transmembrane emp24 domain-containing protein p24delta3 OS=Arabidopsis thaliana GN=At1g09580 PE=1 SV=1 3 208 3.0E-15
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 15 207 4.0E-15
sp|B4NIY1|TMEDA_DROWI Transmembrane emp24 domain-containing protein bai OS=Drosophila willistoni GN=bai PE=3 SV=1 4 208 8.0E-15
sp|A7SXK3|TMED_NEMVE Transmembrane emp24 domain-containing protein OS=Nematostella vectensis GN=v1g194562 PE=3 SV=1 57 208 8.0E-15
sp|P0CN72|TMEDA_CRYNJ Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERV25 PE=3 SV=1 82 206 3.0E-14
sp|P0CN73|TMEDA_CRYNB Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERV25 PE=3 SV=1 82 206 3.0E-14
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 3 208 4.0E-14
sp|Q9LQY3|P24D9_ARATH Transmembrane emp24 domain-containing protein p24delta9 OS=Arabidopsis thaliana GN=At1g26690 PE=2 SV=1 3 208 6.0E-14
sp|Q9FVU0|P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana GN=CYB PE=1 SV=1 3 208 9.0E-14
sp|Q9Y3B3|TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens GN=TMED7 PE=1 SV=2 12 207 2.0E-13
sp|P49020|TMED2_CRIGR Transmembrane emp24 domain-containing protein 2 (Fragment) OS=Cricetulus griseus GN=TMED2 PE=1 SV=1 12 208 2.0E-13
sp|Q63524|TMED2_RAT Transmembrane emp24 domain-containing protein 2 OS=Rattus norvegicus GN=Tmed2 PE=1 SV=1 52 208 3.0E-13
sp|Q15363|TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens GN=TMED2 PE=1 SV=1 52 208 3.0E-13
sp|Q9R0Q3|TMED2_MOUSE Transmembrane emp24 domain-containing protein 2 OS=Mus musculus GN=Tmed2 PE=1 SV=1 52 208 3.0E-13
sp|D3ZTX0|TMED7_RAT Transmembrane emp24 domain-containing protein 7 OS=Rattus norvegicus GN=Tmed7 PE=1 SV=1 12 207 5.0E-13
sp|Q6BTC2|TMEDA_DEBHA Endoplasmic reticulum vesicle protein 25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERV25 PE=3 SV=2 85 204 2.0E-12
sp|Q9P7I9|EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emp24 PE=3 SV=1 70 208 3.0E-12
sp|Q54BN0|TMEDB_DICDI Transmembrane emp24 domain-containing protein B OS=Dictyostelium discoideum GN=empB PE=3 SV=1 4 206 5.0E-12
sp|Q5A302|TMEDA_CANAL Endoplasmic reticulum vesicle protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERV25 PE=3 SV=1 87 204 6.0E-12
sp|O81045|P24D8_ARATH Transmembrane emp24 domain-containing protein p24delta8 OS=Arabidopsis thaliana GN=At2g03290 PE=1 SV=1 15 208 7.0E-12
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 11 204 5.0E-11
sp|Q8GYG1|P24D7_ARATH Transmembrane emp24 domain-containing protein p24delta7 OS=Arabidopsis thaliana GN=At1g14010 PE=2 SV=1 3 208 2.0E-10
sp|Q9HEK4|TMEDA_NEUCR Endoplasmic reticulum vesicle protein 25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erv-1 PE=3 SV=3 85 206 2.0E-10
sp|Q4P958|TMEDA_USTMA Endoplasmic reticulum vesicle protein 25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERV25 PE=3 SV=1 82 206 6.0E-10
sp|Q78IS1|TMED3_MOUSE Transmembrane emp24 domain-containing protein 3 OS=Mus musculus GN=Tmed3 PE=1 SV=1 16 207 7.0E-10
sp|Q6AY25|TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus GN=Tmed3 PE=1 SV=1 16 207 2.0E-09
sp|Q9LJV9|P24DB_ARATH Transmembrane emp24 domain-containing protein p24delta11 OS=Arabidopsis thaliana GN=At3g29070 PE=2 SV=1 13 208 3.0E-09
sp|Q9Y3Q3|TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens GN=TMED3 PE=1 SV=1 16 207 5.0E-09
sp|Q5B5L5|TMEDA_EMENI Endoplasmic reticulum vesicle protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erv25 PE=3 SV=1 87 206 1.0E-08
sp|Q4HY20|TMEDA_GIBZE Endoplasmic reticulum vesicle protein 25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERV25 PE=3 SV=1 82 206 2.0E-08
sp|Q9LIL4|P24B3_ARATH Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana GN=At3g22845 PE=2 SV=1 70 203 4.0E-08
sp|Q6C503|TMEDA_YARLI Endoplasmic reticulum vesicle protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERV25 PE=3 SV=1 87 206 1.0E-07
sp|Q28BQ6|TMED1_XENTR Transmembrane emp24 domain-containing protein 1 OS=Xenopus tropicalis GN=tmed1 PE=2 SV=1 16 209 2.0E-07
sp|Q759T8|TMEDA_ASHGO Endoplasmic reticulum vesicle protein 25 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERV25 PE=3 SV=1 87 203 2.0E-07
sp|Q6CWW7|TMEDA_KLULA Endoplasmic reticulum vesicle protein 25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERV25 PE=3 SV=1 85 203 4.0E-07
sp|Q4WQL0|TMEDA_ASPFU Endoplasmic reticulum vesicle protein 25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erv25 PE=3 SV=1 79 203 9.0E-07
sp|Q6FRZ3|TMEDA_CANGA Endoplasmic reticulum vesicle protein 25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERV25 PE=3 SV=2 85 206 2.0E-06
sp|O13946|TMEDA_SCHPO Endoplasmic reticulum vesicle protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv25 PE=3 SV=1 110 206 3.0E-06
sp|P54837|TMEDA_YEAST Endoplasmic reticulum vesicle protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV25 PE=1 SV=1 85 206 4.0E-06
sp|F4J4Y0|P24D6_ARATH Transmembrane emp24 domain-containing protein p24delta6 OS=Arabidopsis thaliana GN=At3g10780 PE=1 SV=1 15 208 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|095220
MHLLFLLAFAFSANALHFYLDANQHRCFIEELPIDTVVEGNYNALEWSESEQQYVHNPELGIVINVQEEPSGHVV
AQTTGPNQGKFTFTSHEAADHSICLSTNYTTWFSHTHIRLHLDIVVGSTKADVEHDRSHVSELASKLRDLNQKLE
DIRREQQYQREREADFRDLSESTNSRAVWYSVVQIIVLIVTCVWQLRHLKHFFEDRKMR*
Coding >AgabiH97|095220
ATGCACCTCCTCTTCCTCCTCGCTTTCGCTTTCTCTGCAAACGCCCTTCACTTTTATCTCGACGCAAACCAGCAC
CGCTGTTTCATCGAAGAACTTCCCATCGACACCGTCGTCGAAGGAAATTACAACGCTTTGGAATGGTCTGAAAGT
GAACAACAATACGTTCACAACCCAGAACTCGGCATCGTCATCAACGTCCAGGAAGAACCCTCCGGCCACGTCGTT
GCCCAAACAACAGGTCCCAATCAAGGAAAATTCACATTCACATCCCACGAAGCCGCCGACCACTCCATCTGTCTC
TCCACAAACTACACAACATGGTTCAGTCATACCCATATCCGTCTTCACCTCGACATTGTCGTCGGTTCAACCAAA
GCTGATGTTGAACACGACCGTTCTCATGTATCCGAACTCGCTTCAAAACTTCGTGACCTTAATCAAAAATTAGAA
GATATACGTCGAGAACAGCAGTATCAACGGGAACGAGAAGCTGATTTTAGAGACCTGAGTGAATCTACGAATTCA
AGGGCTGTGTGGTATAGCGTCGTTCAGATTATCGTTCTCATCGTTACTTGTGTATGGCAGTTACGCCATCTCAAG
CATTTCTTCGAAGACAGGAAGATGCGATAA
Transcript >AgabiH97|095220
ATGCACCTCCTCTTCCTCCTCGCTTTCGCTTTCTCTGCAAACGCCCTTCACTTTTATCTCGACGCAAACCAGCAC
CGCTGTTTCATCGAAGAACTTCCCATCGACACCGTCGTCGAAGGAAATTACAACGCTTTGGAATGGTCTGAAAGT
GAACAACAATACGTTCACAACCCAGAACTCGGCATCGTCATCAACGTCCAGGAAGAACCCTCCGGCCACGTCGTT
GCCCAAACAACAGGTCCCAATCAAGGAAAATTCACATTCACATCCCACGAAGCCGCCGACCACTCCATCTGTCTC
TCCACAAACTACACAACATGGTTCAGTCATACCCATATCCGTCTTCACCTCGACATTGTCGTCGGTTCAACCAAA
GCTGATGTTGAACACGACCGTTCTCATGTATCCGAACTCGCTTCAAAACTTCGTGACCTTAATCAAAAATTAGAA
GATATACGTCGAGAACAGCAGTATCAACGGGAACGAGAAGCTGATTTTAGAGACCTGAGTGAATCTACGAATTCA
AGGGCTGTGTGGTATAGCGTCGTTCAGATTATCGTTCTCATCGTTACTTGTGTATGGCAGTTACGCCATCTCAAG
CATTTCTTCGAAGACAGGAAGATGCGATAA
Gene >AgabiH97|095220
ATGCACCTCCTCTTCCTCCTCGCTTTCGCTTTCTCTGCAAACGCCCTTCACTTTTATCTCGACGCAAACCAGCAC
CGCTGTTTCATCGAAGAACTTCCCATCGACACCGTCGTCGAAGGTCACTAGCAGTTTGTTGTTTGTCAAATCTCG
CTCACCTCTATTCAGGAAATTACAACGCTTTGGAATGGTCTGAAAGTGAACAACAATACGTTCACAACCCAGAAC
TCGGCATCGTCATCAACGTCCAGGTACGTCAAAAATCCAATCCCACAGCACACACGCTTAATTTTATTCTACAGG
AAGAACCCTCCGGCCACGTCGTTGCCCAAACAACAGGTCCCAATCAAGGAAAATTCACATTCACATCCCACGAAG
CCGCCGACCACTCCATCTGTCTCTCCACAAACTACACAACATGGTTCAGTCATACCCATATCCGTCTTCACCTCG
ACATTGTCGTCGGTTCAACCAAAGCTGATGTTGAACACGACCGTTCTCATGTATCCGAACTCGCTTCAAAACTTC
GTGACCTTAATCAAAAATTAGAAGATATACGTCGAGAACAGCAGTATCAACGGGAACGAGAAGCTGATTTTAGAG
ACCTGAGTGAATCTACGAATTCAAGGGCTGTGTGGTATAGCGTCGTTCAGATTATCGTTCTCATCGTTACTTGTG
TATGGCAGTTACGCCATCTCAAGGTATGTCCCTCTTACTCTTCTACACATTCATTTTTTTTTTTTGAATATCCTT
TTCCTAGCATTTCTTCGAAGACAGGAAGATGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail