Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|095190
Gene name
Locationscaffold_6:1788094..1790292
Strand-
Gene length (bp)2198
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 4.3E-20 26 378
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.8E-07 28 57
PF00890 FAD_binding_2 FAD binding domain 8.4E-05 25 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 33 355 1.0E-23
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 33 436 2.0E-21
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 25 406 7.0E-21
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 28 392 2.0E-18
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 35 392 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 33 355 1.0E-23
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 33 436 2.0E-21
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 25 406 7.0E-21
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 28 392 2.0E-18
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 35 392 5.0E-18
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 124 350 4.0E-16
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 27 401 2.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 27 401 8.0E-14
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 18 349 6.0E-12
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 16 349 6.0E-11
sp|Q93NG3|DHPH_ARTNI 2,6-dihydroxypyridine 3-monooxygenase OS=Arthrobacter nicotinovorans GN=dhpH PE=1 SV=1 28 355 1.0E-09
sp|B2FL98|KMO_STRMK Kynurenine 3-monooxygenase OS=Stenotrophomonas maltophilia (strain K279a) GN=kmo PE=3 SV=1 28 389 1.0E-09
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 164 383 2.0E-09
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 15 349 2.0E-08
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 27 351 4.0E-08
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 27 351 4.0E-08
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 25 354 5.0E-08
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 33 398 1.0E-07
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 33 346 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|095190
MHNELRQDLQKMTLSNSKRPKLLIDFIIVGGGIGGLAMAYALAKSGHGVKVFEKSNGSPTRSGGLRVPPNLTKIL
LEWGLHEELRVAPKCRKSNFHTFETGEIVGHLEWQEDIIREAGADFLLMHHYDLHQALYRLAISVGASVTFETSI
QDVNFNQDARKPCVVLEDGTTVEADVVIGADGHRSIVRNFVAPEVDEGSDTNHSFYTVIVPASAMETDPDLREYA
GLPEWPIWMGDSRGALGYPIRNGTEYNLHVYWPDNEVNSPAIVEESWDLEIPTNAIDFEGYDPRIKKLFNLVPTA
HRARFVRREVVDDWLDESGRVLLVGDAAHPLLPCSTQSASLAVEDAAVLGGLMSRLSTSEQIPQFLEAFCDIRHE
RCKLVQSSELRNAMLVTLPPGEDRDLRNEGMKLSLKTVGDSWDDSMLREQWDEIGEVFGYNAIEAAEDWWIKWGA
LGNAGAQHYVHEAMQDFGVKITTKTAVTEPISSY*
Coding >AgabiH97|095190
ATGCATAACGAGTTGCGTCAGGATTTGCAAAAGATGACACTAAGTAATAGTAAACGACCAAAGTTGTTAATAGAT
TTCATTATCGTGGGTGGAGGAATTGGTGGCCTTGCAATGGCTTATGCTTTAGCCAAGAGTGGTCATGGCGTTAAA
GTATTCGAGAAATCGAATGGTTCCCCGACGCGATCTGGTGGACTACGTGTTCCGCCAAATCTTACAAAGATACTA
TTGGAATGGGGTTTACATGAAGAACTAAGAGTCGCTCCCAAATGTCGCAAAAGTAACTTTCATACTTTTGAGACG
GGGGAAATCGTGGGACACCTTGAATGGCAAGAAGATATCATCCGAGAAGCCGGCGCCGATTTTCTACTAATGCAT
CACTATGACCTCCATCAAGCACTATATCGACTGGCAATTTCCGTAGGAGCTTCTGTCACTTTTGAAACTTCGATA
CAAGACGTCAATTTTAACCAAGATGCACGAAAACCTTGTGTTGTATTGGAAGATGGGACGACTGTGGAGGCGGAT
GTGGTTATAGGCGCCGATGGACATCGTAGCATTGTTCGGAACTTTGTTGCACCCGAAGTGGATGAAGGTTCGGAT
ACTAATCATAGTTTCTACACTGTCATTGTCCCAGCGTCGGCTATGGAAACTGATCCGGATCTGCGAGAATATGCC
GGTCTTCCTGAGTGGCCCATATGGATGGGAGATTCTCGTGGTGCACTCGGCTATCCTATACGAAACGGTACAGAA
TATAATCTTCACGTCTATTGGCCAGACAACGAAGTCAATAGTCCTGCCATCGTAGAAGAAAGTTGGGATTTAGAA
ATCCCGACAAACGCTATAGATTTTGAAGGTTATGATCCTAGGATAAAGAAACTATTCAATTTGGTTCCCACGGCG
CATCGCGCTAGGTTCGTGAGGCGTGAGGTTGTAGATGATTGGTTAGATGAATCTGGTCGTGTTCTCTTGGTAGGA
GATGCGGCACATCCTCTATTGCCTTGTTCAACGCAAAGTGCCAGTCTCGCAGTTGAAGATGCTGCTGTTCTTGGC
GGTTTAATGTCCCGTCTAAGCACATCCGAACAAATCCCTCAATTCCTAGAAGCCTTTTGTGATATCCGACATGAA
CGATGCAAACTAGTCCAGAGTTCTGAACTACGAAACGCCATGTTGGTCACTTTACCACCTGGAGAAGATCGAGAT
TTACGGAATGAGGGAATGAAATTGTCATTGAAGACGGTGGGTGATAGTTGGGATGATAGTATGTTGAGGGAACAG
TGGGATGAAATTGGGGAAGTGTTTGGGTATAATGCGATTGAGGCTGCGGAGGATTGGTGGATTAAGTGGGGGGCA
CTTGGGAATGCGGGTGCTCAGCATTATGTTCATGAGGCCATGCAGGATTTTGGTGTTAAAATCACCACGAAGACT
GCGGTTACTGAACCTATCTCATCGTACTGA
Transcript >AgabiH97|095190
ATGCATAACGAGTTGCGTCAGGATTTGCAAAAGATGACACTAAGTAATAGTAAACGACCAAAGTTGTTAATAGAT
TTCATTATCGTGGGTGGAGGAATTGGTGGCCTTGCAATGGCTTATGCTTTAGCCAAGAGTGGTCATGGCGTTAAA
GTATTCGAGAAATCGAATGGTTCCCCGACGCGATCTGGTGGACTACGTGTTCCGCCAAATCTTACAAAGATACTA
TTGGAATGGGGTTTACATGAAGAACTAAGAGTCGCTCCCAAATGTCGCAAAAGTAACTTTCATACTTTTGAGACG
GGGGAAATCGTGGGACACCTTGAATGGCAAGAAGATATCATCCGAGAAGCCGGCGCCGATTTTCTACTAATGCAT
CACTATGACCTCCATCAAGCACTATATCGACTGGCAATTTCCGTAGGAGCTTCTGTCACTTTTGAAACTTCGATA
CAAGACGTCAATTTTAACCAAGATGCACGAAAACCTTGTGTTGTATTGGAAGATGGGACGACTGTGGAGGCGGAT
GTGGTTATAGGCGCCGATGGACATCGTAGCATTGTTCGGAACTTTGTTGCACCCGAAGTGGATGAAGGTTCGGAT
ACTAATCATAGTTTCTACACTGTCATTGTCCCAGCGTCGGCTATGGAAACTGATCCGGATCTGCGAGAATATGCC
GGTCTTCCTGAGTGGCCCATATGGATGGGAGATTCTCGTGGTGCACTCGGCTATCCTATACGAAACGGTACAGAA
TATAATCTTCACGTCTATTGGCCAGACAACGAAGTCAATAGTCCTGCCATCGTAGAAGAAAGTTGGGATTTAGAA
ATCCCGACAAACGCTATAGATTTTGAAGGTTATGATCCTAGGATAAAGAAACTATTCAATTTGGTTCCCACGGCG
CATCGCGCTAGGTTCGTGAGGCGTGAGGTTGTAGATGATTGGTTAGATGAATCTGGTCGTGTTCTCTTGGTAGGA
GATGCGGCACATCCTCTATTGCCTTGTTCAACGCAAAGTGCCAGTCTCGCAGTTGAAGATGCTGCTGTTCTTGGC
GGTTTAATGTCCCGTCTAAGCACATCCGAACAAATCCCTCAATTCCTAGAAGCCTTTTGTGATATCCGACATGAA
CGATGCAAACTAGTCCAGAGTTCTGAACTACGAAACGCCATGTTGGTCACTTTACCACCTGGAGAAGATCGAGAT
TTACGGAATGAGGGAATGAAATTGTCATTGAAGACGGTGGGTGATAGTTGGGATGATAGTATGTTGAGGGAACAG
TGGGATGAAATTGGGGAAGTGTTTGGGTATAATGCGATTGAGGCTGCGGAGGATTGGTGGATTAAGTGGGGGGCA
CTTGGGAATGCGGGTGCTCAGCATTATGTTCATGAGGCCATGCAGGATTTTGGTGTTAAAATCACCACGAAGACT
GCGGTTACTGAACCTATCTCATCGTACTGA
Gene >AgabiH97|095190
ATGCATAACGAGTTGCGTCAGGATTTGCAAAAGATGACACTAAGTAATAGTAAACGACCAAAGTTGTTAATAGAT
TTCATTATCGTGGGTGGAGGTAAGGCTCTTTACTATTCGTTCATTCGTCGGGATGTTGATTCCGTGTTGCTGTCT
AGGAATTGGTGGCCTTGCAATGGCTTATGCTTTAGCCAAGAGTGGTCATGGCGTTAAAGTATTCGAGAAATCGAA
TGGTTCCCCGACGGTACGCGCGCCTTGTTTCCAAAAGCCAAGGTACTCGTAATCTTATTAACCGCTGATTAGCGA
TCTGGTGGACTACGTGTTCCGCCAAATCTTACAAAGATACTATTGGAATGGGGTTTACATGAAGAACTAAGAGTC
GCTCCCAAATGTCGCAAAAGTAACTTTCATACTTGTGAGTGCGCTTTAAATCCGTTCTTAGTTCTGACCTATACT
CAAAATAATAGTTGAGACGGGGGAAATCGTGGGACACCTTGAATGGCAAGAAGATATCATCCGAGAAGCCGGCGC
CGATTTTCTACTAATGCATGTCAGTCCCACAACCGTTTTTCTCCATTCGTCAAAAAAAAAGCGATCTAACTTGAA
CCCAAATCAATTATTTTAGCACTATGACCTCCATCAAGCACTATATCGACTGGCAATTTCCGTAGGAGCTTCTGT
CACTTTTGAAACTTCGATACAAGACGTCAATTTTAACCAAGATGCACGAAAACCTTGTGTTGTATTGGAAGATGG
GACGACTGTGGAGGCGGATGTGGTTATAGGCGCCGATGGACATCGTAGCATTGTTCGGAACTTTGTTGCACCCGA
AGTGGATGAAGGTTCGGATACTAATCATAGTTTCTACACGTACGTTATCTTTTGGCGTTCTTTTCGGTCCGGTTC
TTTCTTTTGCCTGGTCCCCCTCACATCATCAACCCCCGGTTATACAATTTTTTCGCCTTTGCTTTGCTAATTTGG
GTAAACCTTTTGATTTGTTCTAACTTTGTTGTTGACACAGTGTCATTGTCCCAGCGTCGGCTATGGAAACTGATC
CGGATCTGCGAGAATATGCCGGTCTTCCTGAGGTTCGAAAAATAATATCATTCTTTCATTATTTACCGTTTGACT
GATTATTATTCTTTTCTTTTTCTTTTCTCTTTTCCTTTTTCGTTTTTTTTCTTCTTTTGAATCGTTTAAAGTGGC
CCATATGGATGGGAGATTCTCGTGGTGCACTCGGCTATCCTATAGTAAGTCAACCCTGCAACGTTTCAGATTTCC
CCGTTTGAAAAAAAATCACATCAATCAAAAACTAATGTTTTTTTTTTCTTTTTTTTTTTTTTAGCGAAACGGTAC
AGAATATAATCTTCACGTCTATTGGCCAGACAACGAAGTCAATAGTCCTGCCATCGTAGAAGAAAGTTGGGATTT
AGAAATCCCGACAAACGCTATAGATTTTGAAGGTTATGATCCTAGGTTAGTTTTTTTTTTGTTTTTTTTTTTTTG
ATTGATTGTTTTTTTATGAATGAATGATTTATGGGGTTTTGTTGCAGGATAAAGAAACTATTCAATTTGGTTCCC
ACGGCGCATCGCGCTAGGTTCGTGAGGCGTGAGGTTGTAGATGATTGGTTAGATGAATCTGGTCGTGTTCTCTTG
GTAGGAGATGCGGCACATCCTCTATTGGTAAAGAGAACTTCAAAACAATATATATATCCCCGTTTTGCTCACACG
TTATATTCATCTAGCCTTGTTCAACGCAAAGTGCCAGTCTCGCAGTTGAAGATGCTGCTGTTCTTGGCGGTTTAA
TGTCCCGTCTAAGCACATCCGAACAAATCCCTCAATTCCTAGAAGCCTTTTGTGATATCCGACATGAACGATGCA
AACTAGTCCAGAGTTCTGAACTACGAAACGCCATGTTGGTCACTTTACCACCTGGAGAAGATCGAGATTTACGGA
ATGAGGGAATGAAATTGTCATTGAAGACGGTGGGTGATAGTTGGGATGATAGTATGTTGAGGGAACAGTGGGATG
AAATTGGGGAAGTGTTTGGGTATAATGCGATTGAGGCTGCGGAGGATTGGTGGATTAAGTGGGGGGCACTTGGGA
ATGCGGGTGCTCAGCATTATGTTCATGAGGCCATGCAGGATTTTGGTGTTAAAATCACCACGAAGACTGCGGTTA
CTGAACCTATCTCATCGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail