Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|095000
Gene name
Locationscaffold_6:1732260..1737322
Strand+
Gene length (bp)5062
Transcript length (bp)4560
Coding sequence length (bp)4560
Protein length (aa) 1520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.0E-40 1160 1306
PF00169 PH PH domain 6.2E-15 727 844
PF00787 PX PX domain 5.7E-08 630 710

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 1104 1323 3.0E-42
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 1142 1323 1.0E-30
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 1142 1323 2.0E-27
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 1136 1305 8.0E-24
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 1142 1323 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 1104 1323 3.0E-42
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 1142 1323 1.0E-30
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 1142 1323 2.0E-27
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 1136 1305 8.0E-24
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 1142 1323 2.0E-23
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 1126 1305 3.0E-23
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 1142 1323 1.0E-22
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 1140 1323 2.0E-22
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 1141 1305 6.0E-22
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 1141 1305 1.0E-21
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 1126 1305 1.0E-21
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 1124 1305 2.0E-21
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 1140 1323 3.0E-21
sp|Q55DW9|GACZ_DICDI Rho GTPase-activating protein gacZ OS=Dictyostelium discoideum GN=gacZ PE=3 SV=1 1143 1325 3.0E-21
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 1098 1323 9.0E-21
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 1124 1305 1.0E-20
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 1124 1305 3.0E-20
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 1123 1305 4.0E-20
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 1124 1305 7.0E-20
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 1107 1323 7.0E-20
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 1133 1305 1.0E-19
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 1159 1311 3.0E-19
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 1150 1305 8.0E-19
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 1158 1311 9.0E-19
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 1142 1305 1.0E-18
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 1133 1323 2.0E-18
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 1137 1323 2.0E-18
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 1133 1308 2.0E-18
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 1133 1356 2.0E-18
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 1158 1311 2.0E-18
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 1133 1308 2.0E-18
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 1158 1311 3.0E-18
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 1142 1321 3.0E-18
sp|P55194|3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus GN=Sh3bp1 PE=1 SV=2 1142 1308 3.0E-18
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 1137 1323 3.0E-18
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 1158 1311 4.0E-18
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 1160 1308 4.0E-18
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 1133 1305 4.0E-18
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 1137 1323 4.0E-18
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 1133 1305 5.0E-18
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 1133 1308 5.0E-18
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 1160 1308 5.0E-18
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 1142 1309 5.0E-18
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 1133 1305 6.0E-18
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 1150 1305 6.0E-18
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 1160 1305 1.0E-17
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 1142 1309 1.0E-17
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 1142 1323 1.0E-17
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 1143 1305 1.0E-17
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 1133 1308 1.0E-17
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 1142 1308 1.0E-17
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 1142 1305 1.0E-17
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 1133 1308 1.0E-17
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 1143 1305 1.0E-17
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 1143 1305 1.0E-17
sp|Q9VDS5|RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster GN=RhoGAP92B PE=1 SV=1 1143 1308 2.0E-17
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 1167 1308 2.0E-17
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 1142 1323 2.0E-17
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 1142 1305 3.0E-17
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 1142 1325 4.0E-17
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 1142 1305 4.0E-17
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 1137 1305 5.0E-17
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 1126 1308 8.0E-17
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 1133 1305 8.0E-17
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 1160 1305 9.0E-17
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 1133 1305 1.0E-16
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 1139 1309 1.0E-16
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 1160 1308 1.0E-16
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 1138 1308 1.0E-16
sp|Q8SSN9|GACF_DICDI Rho GTPase-activating protein gacF OS=Dictyostelium discoideum GN=gacF PE=3 SV=2 1143 1305 2.0E-16
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 1159 1319 3.0E-16
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 1141 1333 4.0E-16
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 1106 1326 5.0E-16
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 1142 1305 5.0E-16
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 1133 1336 5.0E-16
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 1141 1305 9.0E-16
sp|Q9BRR9|RHG09_HUMAN Rho GTPase-activating protein 9 OS=Homo sapiens GN=ARHGAP9 PE=1 SV=2 1141 1323 2.0E-15
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 1141 1308 2.0E-15
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 1159 1305 2.0E-15
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 1159 1305 2.0E-15
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 1141 1315 3.0E-15
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 1141 1308 3.0E-15
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 1141 1315 4.0E-15
sp|Q86I31|GACFF_DICDI Rho GTPase-activating protein gacFF OS=Dictyostelium discoideum GN=gacFF PE=2 SV=1 1142 1305 4.0E-15
sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 1104 1308 4.0E-15
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 1141 1305 4.0E-15
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 1142 1305 6.0E-15
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 1141 1308 2.0E-14
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=GMIP PE=1 SV=2 1158 1305 3.0E-14
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 1159 1305 4.0E-14
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 1159 1305 5.0E-14
sp|Q6IFT4|RHG20_MOUSE Rho GTPase-activating protein 20 OS=Mus musculus GN=Arhgap20 PE=1 SV=1 1138 1435 5.0E-14
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 592 850 6.0E-14
sp|Q54MV3|GACJ_DICDI Rho GTPase-activating protein gacJ OS=Dictyostelium discoideum GN=gacJ PE=3 SV=1 1143 1323 6.0E-14
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 1143 1306 7.0E-14
sp|P42331|RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens GN=ARHGAP25 PE=1 SV=2 1133 1305 8.0E-14
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 1159 1305 9.0E-14
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 1159 1305 9.0E-14
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 1141 1308 1.0E-13
sp|P0CAX5|OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus GN=Ophn1 PE=1 SV=1 1116 1305 1.0E-13
sp|Q6PGG2|GMIP_MOUSE GEM-interacting protein OS=Mus musculus GN=Gmip PE=1 SV=1 1158 1308 1.0E-13
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 1142 1310 1.0E-13
sp|Q6REY9|RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus GN=Arhgap20 PE=1 SV=2 1138 1308 2.0E-13
sp|Q6ZW31|SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens GN=SYDE1 PE=1 SV=1 1141 1309 2.0E-13
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 1143 1305 2.0E-13
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 1136 1308 2.0E-13
sp|Q99J31|OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus GN=Ophn1 PE=1 SV=1 1116 1305 2.0E-13
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 1139 1305 3.0E-13
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 1132 1305 4.0E-13
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 1143 1305 5.0E-13
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 1143 1305 6.0E-13
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 560 848 8.0E-13
sp|Q54G18|GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum GN=gacW PE=3 SV=1 1159 1305 8.0E-13
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 1142 1305 1.0E-12
sp|Q8BYW1|RHG25_MOUSE Rho GTPase-activating protein 25 OS=Mus musculus GN=Arhgap25 PE=1 SV=2 1142 1305 1.0E-12
sp|Q54YV1|GACII_DICDI Rho GTPase-activating protein gacII OS=Dictyostelium discoideum GN=gacII PE=3 SV=1 1160 1325 1.0E-12
sp|Q7YQL5|OPHN1_PONPY Oligophrenin-1 OS=Pongo pygmaeus GN=OPHN1 PE=2 SV=1 1162 1305 2.0E-12
sp|Q7YQL6|OPHN1_PANTR Oligophrenin-1 OS=Pan troglodytes GN=OPHN1 PE=2 SV=1 1162 1305 2.0E-12
sp|O60890|OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens GN=OPHN1 PE=1 SV=1 1162 1305 2.0E-12
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 1141 1309 2.0E-12
sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 1134 1305 3.0E-12
sp|P85298|RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens GN=ARHGAP8 PE=1 SV=1 1143 1314 3.0E-12
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens GN=TAGAP PE=1 SV=1 1112 1354 4.0E-12
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 1159 1328 5.0E-12
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 1161 1337 5.0E-12
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 1142 1305 5.0E-12
sp|Q6ZM89|RH42A_DANRE Rho GTPase-activating protein 42 OS=Danio rerio GN=arhgap42a PE=2 SV=3 1161 1305 7.0E-12
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 1159 1310 8.0E-12
sp|Q54NL0|GACT_DICDI Rho GTPase-activating protein gacT OS=Dictyostelium discoideum GN=gacT PE=3 SV=1 1140 1323 9.0E-12
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 1159 1305 9.0E-12
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 1161 1308 1.0E-11
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 1161 1337 1.0E-11
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 1142 1305 2.0E-11
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 1140 1305 2.0E-11
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 1140 1305 3.0E-11
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 1142 1310 3.0E-11
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 1161 1337 3.0E-11
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 1140 1305 4.0E-11
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 1161 1337 4.0E-11
sp|Q553X3|GACI_DICDI Rho GTPase-activating protein gacI OS=Dictyostelium discoideum GN=gacI PE=3 SV=1 1138 1308 4.0E-11
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 1161 1337 4.0E-11
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 1180 1305 4.0E-11
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 1158 1326 4.0E-11
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 1140 1305 5.0E-11
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 1180 1305 5.0E-11
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 1142 1305 6.0E-11
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 1161 1308 6.0E-11
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 1161 1337 7.0E-11
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 1143 1305 8.0E-11
sp|B0S6J3|SRGP2_DANRE SLIT-ROBO Rho GTPase-activating protein 2 OS=Danio rerio GN=srgap2 PE=2 SV=1 1159 1310 9.0E-11
sp|P39083|RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA1 PE=1 SV=1 1157 1305 1.0E-10
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 1140 1305 1.0E-10
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 1143 1305 1.0E-10
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 1158 1326 1.0E-10
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 1143 1325 2.0E-10
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 1143 1305 2.0E-10
sp|Q9VDG2|RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster GN=Rlip PE=1 SV=1 1142 1323 2.0E-10
sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo sapiens GN=ARHGAP28 PE=1 SV=3 1142 1305 3.0E-10
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 1159 1310 4.0E-10
sp|Q54J98|GACX_DICDI Rho GTPase-activating protein gacX OS=Dictyostelium discoideum GN=gacX PE=3 SV=1 1158 1310 4.0E-10
sp|Q54XT6|GACR_DICDI Rho GTPase-activating protein gacR OS=Dictyostelium discoideum GN=gacR PE=3 SV=1 1142 1308 5.0E-10
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 1177 1310 6.0E-10
sp|Q9NYF5|FA13B_HUMAN Protein FAM13B OS=Homo sapiens GN=FAM13B PE=2 SV=2 1136 1280 1.0E-09
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 1130 1308 1.0E-09
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 1159 1310 1.0E-09
sp|Q54FF4|GACL_DICDI Rho GTPase-activating protein gacL OS=Dictyostelium discoideum GN=gacL PE=2 SV=1 1138 1305 1.0E-09
sp|Q54QF4|MGP4_DICDI Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum GN=mgp4 PE=3 SV=1 1142 1305 1.0E-09
sp|Q8K2H3|FA13B_MOUSE Protein FAM13B OS=Mus musculus GN=Fam13b PE=1 SV=1 1142 1280 1.0E-09
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 1159 1310 2.0E-09
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 1159 1305 2.0E-09
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 1140 1305 3.0E-09
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 1141 1308 3.0E-09
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 1159 1310 5.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 1162 1323 5.0E-09
sp|Q06407|RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA2 PE=1 SV=1 1179 1305 6.0E-09
sp|Q55GP8|GACO_DICDI Rho GTPase-activating protein gacO OS=Dictyostelium discoideum GN=gacO PE=3 SV=1 1179 1305 9.0E-09
sp|Q5RB40|HMHA1_PONAB Minor histocompatibility protein HA-1 OS=Pongo abelii GN=HMHA1 PE=2 SV=1 1159 1308 1.0E-08
sp|Q92619|HMHA1_HUMAN Minor histocompatibility protein HA-1 OS=Homo sapiens GN=HMHA1 PE=1 SV=2 1159 1308 1.0E-08
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 1159 1305 1.0E-08
sp|Q8WZ64|ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ARAP2 PE=1 SV=3 1218 1325 1.0E-08
sp|Q8BZ05|ARAP2_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Arap2 PE=1 SV=2 1150 1325 1.0E-08
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 1140 1305 2.0E-08
sp|A7YY57|RHG29_BOVIN Rho GTPase-activating protein 29 OS=Bos taurus GN=ARHGAP29 PE=2 SV=1 1179 1308 2.0E-08
sp|Q5PQJ5|RHG29_RAT Rho GTPase-activating protein 29 OS=Rattus norvegicus GN=Arhgap29 PE=1 SV=2 1179 1308 2.0E-08
sp|Q8CGF1|RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus GN=Arhgap29 PE=1 SV=1 1179 1308 4.0E-08
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 688 869 5.0E-08
sp|Q12128|BAG7_YEAST Rho-GTPase-activating protein BAG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAG7 PE=1 SV=1 1142 1305 5.0E-08
sp|Q52LW3|RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens GN=ARHGAP29 PE=1 SV=2 1179 1308 7.0E-08
sp|B2RWW0|TAGAP_MOUSE T-cell activation Rho GTPase-activating protein OS=Mus musculus GN=Tagap PE=2 SV=2 1113 1401 8.0E-08
sp|Q54XE8|GACP_DICDI Rho GTPase-activating protein gacP OS=Dictyostelium discoideum GN=gacP PE=3 SV=1 1159 1271 1.0E-07
sp|Q5F3G0|RHG19_CHICK Rho GTPase-activating protein 19 OS=Gallus gallus GN=ARHGAP19 PE=2 SV=1 1142 1311 2.0E-07
sp|Q9C0H5|RHG39_HUMAN Rho GTPase-activating protein 39 OS=Homo sapiens GN=ARHGAP39 PE=1 SV=2 1136 1305 2.0E-07
sp|Q8BRH3|RHG19_MOUSE Rho GTPase-activating protein 19 OS=Mus musculus GN=Arhgap19 PE=1 SV=2 1142 1311 3.0E-07
sp|Q86NH1|SYD1_CAEEL Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans GN=syd-1 PE=2 SV=1 1142 1313 3.0E-07
sp|P59281|RHG39_MOUSE Rho GTPase-activating protein 39 OS=Mus musculus GN=Arhgap39 PE=1 SV=2 1136 1305 3.0E-07
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 623 777 4.0E-07
sp|O74335|RGA5_SCHPO Rho-GTPase-activating protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga5 PE=3 SV=2 1142 1303 4.0E-07
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 1158 1327 5.0E-07
sp|Q8K031|STAR8_MOUSE StAR-related lipid transfer protein 8 OS=Mus musculus GN=Stard8 PE=1 SV=2 1141 1305 6.0E-07
sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 OS=Homo sapiens GN=STARD8 PE=1 SV=2 1140 1305 9.0E-07
sp|Q54BF1|GACE_DICDI Rho GTPase-activating protein gacE OS=Dictyostelium discoideum GN=gacE PE=3 SV=1 1173 1305 1.0E-06
sp|Q61CA4|SYD1_CAEBR Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae GN=syd-1 PE=3 SV=2 1142 1305 1.0E-06
sp|Q55DK5|MGP3_DICDI Mental retardation GTPase activating protein homolog 3 OS=Dictyostelium discoideum GN=mgp3 PE=3 SV=1 1141 1305 1.0E-06
sp|Q9CAX8|RGAP4_ARATH Rho GTPase-activating protein 4 OS=Arabidopsis thaliana GN=ROPGAP4 PE=2 SV=1 1142 1330 2.0E-06
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 1158 1327 3.0E-06
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 1121 1305 3.0E-06
sp|Q9VX32|RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster GN=RhoGAPp190 PE=1 SV=2 1159 1305 5.0E-06
sp|Q14CB8|RHG19_HUMAN Rho GTPase-activating protein 19 OS=Homo sapiens GN=ARHGAP19 PE=1 SV=1 1142 1311 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0005543 phospholipid binding No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 1262 1284 22
2 1297 1319 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|095000
MATRDRLAPQSPLQPQRSSSSPSSSTSALPSSSTSTSLSHSQPLSSTSLLRQHEAAPDSKLAALEQAVNERNVLA
AQNTQLWKLIEKQRSGYNQIIKELDRIRGERDAYKAKVVALGGSADRKSQKSADRKTRTEVDSGDAPSRQHSQDN
STPRLHSSRSYNESLRNNDSTSSTSINSGTLPPPPPSAPASSTPTSSKYQKSLPNAPSHSDSQSLPVSASASISS
DEPPQIRKGSIAESISSVSSSMNYNASALTTATSSSIHSSSSPSANASSTTSVQITMSPASPQTPRVSLSQTSIK
AEARPMLPPMDPRSSRITLPDEARQYIVNMVDSPSPSPKLDSFSSSKPKVSSNLVPQQQDDSSKPEASEFLDLED
DDEDAEDVELYDDEAEFRRSVHDQNQTKAADSAVPDSRIDHSTTTPPDRQPHSDAPNFTNPFHDPPNTGQDPSQV
GVPSEDLSSTSSQHSLPPEFATDQSTEMDQATPGPHQLLINDNSGSSSIGPPSQPHHQFYHHTPLQQQPQQQQQV
GPSHSNYPSVSLPSAYLSHQQMSQQQMMPVAAPPRTDSRPVVESTSTLSSLEPPPTRKRDREHYRALPLLPTDLP
TTIVSVSHSSVRPNDRGKEVLWFVITVNPGSGKEPWKVEKRYSDVVTLDSRVRASVGKSVAKKITGLPEGKFWKD
HAPAKVDQRKALLESYLQSLLKLPIRHNDEAIAFLTTDIVRETRQPVMQAGHKEGYLTKRGKNFGGWKTRYFVLQ
GPVLEYYESRGGTHLGSIVITGAQIGRQQRNSDRQNSNSNHNNPNGGSNYHDDEKEYRHAFLIVEAKKGPGGSHP
RHVLCAESDEERDAWVEMLVRYFTGVYSEEPLNYGAPPPPVASSSHHLVKQPQRGLSKDEILVSKGVPLSQLQQD
PSNAKLFSTPHNVDEINNLERPGSPVKSLDQLSIERQISQGGGQNSKSASNDTAKRVLERLQGLPSSLPDAPSML
SGVGNVEVVGGPRPNSEMGHYGRDGMTEMMDKRKSSRNHSPERYRYDVRKTSLYPSNSSNNNSSSNSNSNLSTPG
SNNMNRSPSPDKMDGGGGASTTKPKISAPMGGQPIPSGFKWGGGESNVGGSGGDGGAGAGSNRREKARSRFWPGA
WRQTNGEKQVAVVPRNVFGIPLEESLEVSQICNLPSIVFRSIEYLEAKKADQEEGIYRLSGSSAVIKSLKDRFNA
EGDLNLLASDEYWDPHAIAGLLKSYLRELPASILTRELHFRFLSVIDFVDPQERIRELSQLIASLPIANYSILRA
LTAHLILIVQNASVNKMTMRNVGIVFSPTLGIPAGVFSLMLGEFNRVFNVDAGRDLDNHSAVASEDGLEPLHEEG
GDDVSKRNRNSRHYSHAAADQILGLGGRSLNTSADDPQSDTDDYSVQDESGTETTGDGEMTAESVSGSISTPSRD
RDHQDSFHHPHHQQQQQHTIRISGPPDTPVAARISKAASTANSKGLNLNAVGKRGTTSGLGGGLIGLPTSPRPML
SPSRADISAPPPPPQSFLG*
Coding >AgabiH97|095000
ATGGCCACCCGCGACAGACTCGCTCCCCAGTCCCCGCTCCAGCCACAGCGCTCGTCCAGCTCGCCGTCGTCGTCC
ACCTCGGCCCTCCCCTCGTCGTCTACCTCGACTTCCCTCTCCCACTCCCAGCCTCTCTCCTCCACTTCTCTTCTC
AGGCAGCACGAAGCCGCCCCAGATTCAAAGCTCGCCGCCTTGGAACAGGCTGTCAACGAACGCAATGTCCTCGCC
GCTCAGAATACCCAGCTCTGGAAGCTCATCGAAAAGCAGCGGTCAGGCTACAATCAGATTATCAAAGAACTCGAC
AGAATCAGGGGCGAGCGTGATGCATACAAAGCAAAGGTAGTCGCCCTCGGTGGCTCCGCAGACAGAAAGAGCCAG
AAATCTGCAGATCGCAAGACGCGCACCGAGGTCGACTCTGGAGACGCCCCTTCACGACAACACTCGCAAGATAAT
AGTACTCCCCGACTACATTCCTCTCGCTCGTACAACGAGTCTCTCCGCAACAACGACAGCACCTCATCCACGAGC
ATAAATTCCGGCACCCTGCCACCGCCACCACCCAGTGCCCCTGCCTCGTCCACCCCCACTTCTTCAAAGTACCAA
AAATCTCTCCCAAATGCACCATCCCATTCCGACTCCCAGTCACTTCCCGTATCCGCATCCGCATCCATTTCTTCA
GATGAACCACCGCAGATTCGCAAAGGCAGTATTGCCGAAAGCATCAGCAGCGTCAGTTCCAGCATGAACTATAAT
GCCTCCGCACTTACGACAGCCACATCCTCGAGTATCCATTCTTCCTCTTCCCCATCCGCGAACGCTTCGTCTACT
ACGTCGGTACAGATCACTATGTCGCCCGCCTCGCCCCAAACTCCCCGTGTTTCTCTCAGTCAGACATCAATCAAA
GCCGAGGCGCGACCTATGCTTCCTCCAATGGACCCTCGTAGCTCCCGCATCACTCTTCCCGACGAAGCCAGGCAA
TATATTGTCAACATGGTTGACTCGCCCTCTCCAAGTCCCAAGCTCGACTCTTTTTCTTCGTCCAAGCCCAAGGTT
TCCTCCAATCTTGTTCCTCAGCAGCAAGACGACTCATCGAAACCCGAAGCCTCAGAATTCCTCGACCTGGAAGAC
GACGACGAGGATGCTGAGGATGTGGAATTGTACGATGACGAAGCTGAATTCAGAAGATCTGTTCATGATCAGAAT
CAAACCAAGGCCGCCGATTCGGCTGTTCCGGATTCCAGAATTGATCACAGTACAACAACCCCGCCAGACCGGCAA
CCTCACTCTGACGCTCCCAACTTCACTAATCCATTCCATGACCCCCCAAATACTGGCCAAGATCCAAGCCAAGTA
GGGGTCCCATCTGAGGATTTGTCCTCAACGTCCTCACAGCACTCGCTACCGCCGGAATTTGCGACTGATCAATCT
ACCGAAATGGATCAGGCTACACCCGGGCCGCATCAGTTGCTCATCAACGATAATTCCGGTTCGTCGTCAATTGGA
CCTCCATCCCAACCCCATCATCAGTTTTATCATCATACGCCACTGCAACAACAGCCGCAACAGCAACAGCAAGTG
GGACCCAGTCATTCGAATTATCCCTCAGTTTCACTACCGTCAGCATATCTATCCCACCAGCAAATGAGCCAACAA
CAAATGATGCCCGTAGCTGCACCACCACGCACAGACTCTCGACCGGTCGTTGAGTCCACCTCAACGCTTAGCTCG
CTCGAACCCCCTCCCACGCGCAAACGTGACAGAGAGCATTACCGGGCGCTACCCCTCCTGCCCACTGATTTACCG
ACCACCATTGTTTCGGTTTCTCACTCTTCTGTTCGCCCTAACGACAGAGGCAAGGAGGTACTCTGGTTTGTGATT
ACCGTAAATCCAGGGAGTGGGAAGGAACCATGGAAAGTGGAGAAAAGGTATTCTGATGTGGTCACCCTGGATTCC
AGGGTTCGGGCAAGTGTCGGCAAGTCTGTTGCGAAGAAGATTACTGGTTTACCTGAGGGGAAATTTTGGAAGGAT
CATGCACCCGCAAAAGTTGACCAACGAAAGGCGCTACTGGAGTCTTATCTCCAATCACTTCTGAAGTTGCCAATC
AGACATAACGATGAGGCCATTGCATTCCTCACCACCGATATTGTTCGCGAGACTCGTCAACCAGTCATGCAAGCA
GGTCATAAAGAAGGATATTTGACGAAAAGGGGCAAAAACTTTGGAGGGTGGAAAACGCGGTATTTTGTTCTACAA
GGCCCCGTACTTGAATACTATGAATCCCGTGGAGGTACGCACCTGGGTTCGATCGTGATCACTGGTGCGCAAATT
GGGCGCCAGCAACGTAACTCCGATAGGCAGAACTCCAACTCGAATCACAATAACCCTAATGGCGGCTCTAACTAT
CATGATGACGAGAAGGAGTATCGTCACGCTTTTCTAATTGTTGAAGCCAAAAAGGGACCTGGAGGTTCACACCCA
AGGCACGTGCTGTGCGCTGAGAGTGATGAAGAGAGAGACGCTTGGGTTGAGATGCTCGTGCGGTACTTTACTGGT
GTATACAGTGAGGAACCATTGAATTATGGCGCTCCTCCTCCCCCTGTCGCCTCCTCCTCTCATCACCTTGTGAAG
CAACCACAAAGAGGGCTATCGAAAGACGAGATCTTGGTTTCGAAAGGCGTTCCACTTTCACAACTCCAACAAGAC
CCGAGCAATGCGAAATTATTCTCGACACCGCATAACGTGGACGAGATTAATAATCTGGAACGACCTGGGAGTCCC
GTCAAATCCCTGGATCAATTATCTATTGAACGACAGATTTCACAAGGTGGCGGACAAAATAGCAAATCTGCGAGT
AATGATACTGCGAAGAGGGTTTTGGAGAGACTTCAAGGTCTTCCTTCGAGTTTACCTGATGCACCGTCAATGCTT
TCTGGCGTTGGCAACGTTGAGGTTGTGGGTGGTCCTCGACCGAATTCGGAAATGGGCCATTACGGTCGTGACGGT
ATGACAGAGATGATGGATAAGAGGAAATCTTCAAGGAATCATTCACCTGAAAGGTATCGATATGATGTTCGAAAG
ACTTCTCTTTATCCTTCAAATAGCAGCAACAACAATTCGAGCTCGAATTCGAACTCGAATCTCAGCACTCCCGGA
TCTAATAACATGAACAGATCTCCATCACCCGATAAGATGGACGGTGGTGGTGGTGCAAGTACTACGAAGCCGAAA
ATTTCAGCGCCGATGGGCGGACAACCTATTCCTTCTGGATTTAAATGGGGTGGGGGAGAGAGTAATGTTGGAGGA
TCGGGAGGTGATGGTGGTGCTGGAGCCGGGAGTAATAGACGGGAGAAGGCTAGATCAAGATTTTGGCCTGGGGCG
TGGAGACAAACGAATGGGGAAAAACAGGTCGCGGTAGTACCTCGAAACGTGTTTGGGATACCTCTGGAAGAATCA
CTCGAGGTTTCGCAGATATGTAACTTGCCATCGATCGTCTTCAGGTCCATTGAATATTTGGAAGCGAAGAAAGCC
GATCAGGAGGAGGGTATCTATAGGTTGAGCGGGAGTTCTGCGGTTATCAAGAGTTTGAAAGATCGTTTCAATGCT
GAGGGTGATTTGAATTTGTTGGCTAGCGATGAATACTGGGACCCTCATGCTATTGCTGGCTTACTCAAGAGTTAC
TTGAGGGAGTTACCGGCGAGTATCCTGACAAGGGAGCTACATTTCAGGTTCCTGTCCGTTATCGACTTTGTTGAT
CCCCAGGAACGAATCCGAGAATTATCTCAACTCATTGCATCACTGCCAATCGCGAATTACAGTATTCTCCGTGCG
CTTACGGCTCATTTAATACTGATCGTACAAAATGCAAGTGTCAACAAAATGACGATGCGGAATGTCGGTATTGTC
TTTTCGCCGACATTGGGTATACCGGCAGGAGTCTTCAGCTTAATGCTTGGAGAGTTCAATCGAGTTTTTAATGTT
GATGCTGGTCGGGACCTTGACAATCATAGTGCGGTTGCGAGCGAAGATGGACTCGAACCATTACATGAAGAGGGA
GGGGACGATGTTTCGAAGAGGAATAGGAATAGCAGGCATTACTCTCATGCGGCCGCAGATCAGATTCTGGGACTC
GGAGGACGAAGCCTTAACACATCCGCGGATGACCCGCAATCGGACACGGATGATTACTCCGTACAAGATGAGAGT
GGGACCGAGACGACGGGTGATGGTGAGATGACAGCCGAATCGGTGTCGGGGTCAATCTCGACACCCAGCCGTGAT
CGAGATCATCAGGACTCCTTCCACCATCCACATCATCAGCAACAACAACAGCATACGATACGAATTAGTGGTCCC
CCTGACACTCCCGTAGCGGCAAGGATTTCAAAGGCGGCAAGTACGGCAAATAGCAAAGGCTTGAATTTGAATGCG
GTGGGTAAACGAGGAACGACGAGTGGCCTTGGTGGTGGTCTCATTGGATTACCTACGTCGCCCAGACCGATGCTT
TCGCCTTCAAGGGCGGACATTTCTGCACCACCACCACCACCGCAATCTTTTTTGGGATGA
Transcript >AgabiH97|095000
ATGGCCACCCGCGACAGACTCGCTCCCCAGTCCCCGCTCCAGCCACAGCGCTCGTCCAGCTCGCCGTCGTCGTCC
ACCTCGGCCCTCCCCTCGTCGTCTACCTCGACTTCCCTCTCCCACTCCCAGCCTCTCTCCTCCACTTCTCTTCTC
AGGCAGCACGAAGCCGCCCCAGATTCAAAGCTCGCCGCCTTGGAACAGGCTGTCAACGAACGCAATGTCCTCGCC
GCTCAGAATACCCAGCTCTGGAAGCTCATCGAAAAGCAGCGGTCAGGCTACAATCAGATTATCAAAGAACTCGAC
AGAATCAGGGGCGAGCGTGATGCATACAAAGCAAAGGTAGTCGCCCTCGGTGGCTCCGCAGACAGAAAGAGCCAG
AAATCTGCAGATCGCAAGACGCGCACCGAGGTCGACTCTGGAGACGCCCCTTCACGACAACACTCGCAAGATAAT
AGTACTCCCCGACTACATTCCTCTCGCTCGTACAACGAGTCTCTCCGCAACAACGACAGCACCTCATCCACGAGC
ATAAATTCCGGCACCCTGCCACCGCCACCACCCAGTGCCCCTGCCTCGTCCACCCCCACTTCTTCAAAGTACCAA
AAATCTCTCCCAAATGCACCATCCCATTCCGACTCCCAGTCACTTCCCGTATCCGCATCCGCATCCATTTCTTCA
GATGAACCACCGCAGATTCGCAAAGGCAGTATTGCCGAAAGCATCAGCAGCGTCAGTTCCAGCATGAACTATAAT
GCCTCCGCACTTACGACAGCCACATCCTCGAGTATCCATTCTTCCTCTTCCCCATCCGCGAACGCTTCGTCTACT
ACGTCGGTACAGATCACTATGTCGCCCGCCTCGCCCCAAACTCCCCGTGTTTCTCTCAGTCAGACATCAATCAAA
GCCGAGGCGCGACCTATGCTTCCTCCAATGGACCCTCGTAGCTCCCGCATCACTCTTCCCGACGAAGCCAGGCAA
TATATTGTCAACATGGTTGACTCGCCCTCTCCAAGTCCCAAGCTCGACTCTTTTTCTTCGTCCAAGCCCAAGGTT
TCCTCCAATCTTGTTCCTCAGCAGCAAGACGACTCATCGAAACCCGAAGCCTCAGAATTCCTCGACCTGGAAGAC
GACGACGAGGATGCTGAGGATGTGGAATTGTACGATGACGAAGCTGAATTCAGAAGATCTGTTCATGATCAGAAT
CAAACCAAGGCCGCCGATTCGGCTGTTCCGGATTCCAGAATTGATCACAGTACAACAACCCCGCCAGACCGGCAA
CCTCACTCTGACGCTCCCAACTTCACTAATCCATTCCATGACCCCCCAAATACTGGCCAAGATCCAAGCCAAGTA
GGGGTCCCATCTGAGGATTTGTCCTCAACGTCCTCACAGCACTCGCTACCGCCGGAATTTGCGACTGATCAATCT
ACCGAAATGGATCAGGCTACACCCGGGCCGCATCAGTTGCTCATCAACGATAATTCCGGTTCGTCGTCAATTGGA
CCTCCATCCCAACCCCATCATCAGTTTTATCATCATACGCCACTGCAACAACAGCCGCAACAGCAACAGCAAGTG
GGACCCAGTCATTCGAATTATCCCTCAGTTTCACTACCGTCAGCATATCTATCCCACCAGCAAATGAGCCAACAA
CAAATGATGCCCGTAGCTGCACCACCACGCACAGACTCTCGACCGGTCGTTGAGTCCACCTCAACGCTTAGCTCG
CTCGAACCCCCTCCCACGCGCAAACGTGACAGAGAGCATTACCGGGCGCTACCCCTCCTGCCCACTGATTTACCG
ACCACCATTGTTTCGGTTTCTCACTCTTCTGTTCGCCCTAACGACAGAGGCAAGGAGGTACTCTGGTTTGTGATT
ACCGTAAATCCAGGGAGTGGGAAGGAACCATGGAAAGTGGAGAAAAGGTATTCTGATGTGGTCACCCTGGATTCC
AGGGTTCGGGCAAGTGTCGGCAAGTCTGTTGCGAAGAAGATTACTGGTTTACCTGAGGGGAAATTTTGGAAGGAT
CATGCACCCGCAAAAGTTGACCAACGAAAGGCGCTACTGGAGTCTTATCTCCAATCACTTCTGAAGTTGCCAATC
AGACATAACGATGAGGCCATTGCATTCCTCACCACCGATATTGTTCGCGAGACTCGTCAACCAGTCATGCAAGCA
GGTCATAAAGAAGGATATTTGACGAAAAGGGGCAAAAACTTTGGAGGGTGGAAAACGCGGTATTTTGTTCTACAA
GGCCCCGTACTTGAATACTATGAATCCCGTGGAGGTACGCACCTGGGTTCGATCGTGATCACTGGTGCGCAAATT
GGGCGCCAGCAACGTAACTCCGATAGGCAGAACTCCAACTCGAATCACAATAACCCTAATGGCGGCTCTAACTAT
CATGATGACGAGAAGGAGTATCGTCACGCTTTTCTAATTGTTGAAGCCAAAAAGGGACCTGGAGGTTCACACCCA
AGGCACGTGCTGTGCGCTGAGAGTGATGAAGAGAGAGACGCTTGGGTTGAGATGCTCGTGCGGTACTTTACTGGT
GTATACAGTGAGGAACCATTGAATTATGGCGCTCCTCCTCCCCCTGTCGCCTCCTCCTCTCATCACCTTGTGAAG
CAACCACAAAGAGGGCTATCGAAAGACGAGATCTTGGTTTCGAAAGGCGTTCCACTTTCACAACTCCAACAAGAC
CCGAGCAATGCGAAATTATTCTCGACACCGCATAACGTGGACGAGATTAATAATCTGGAACGACCTGGGAGTCCC
GTCAAATCCCTGGATCAATTATCTATTGAACGACAGATTTCACAAGGTGGCGGACAAAATAGCAAATCTGCGAGT
AATGATACTGCGAAGAGGGTTTTGGAGAGACTTCAAGGTCTTCCTTCGAGTTTACCTGATGCACCGTCAATGCTT
TCTGGCGTTGGCAACGTTGAGGTTGTGGGTGGTCCTCGACCGAATTCGGAAATGGGCCATTACGGTCGTGACGGT
ATGACAGAGATGATGGATAAGAGGAAATCTTCAAGGAATCATTCACCTGAAAGGTATCGATATGATGTTCGAAAG
ACTTCTCTTTATCCTTCAAATAGCAGCAACAACAATTCGAGCTCGAATTCGAACTCGAATCTCAGCACTCCCGGA
TCTAATAACATGAACAGATCTCCATCACCCGATAAGATGGACGGTGGTGGTGGTGCAAGTACTACGAAGCCGAAA
ATTTCAGCGCCGATGGGCGGACAACCTATTCCTTCTGGATTTAAATGGGGTGGGGGAGAGAGTAATGTTGGAGGA
TCGGGAGGTGATGGTGGTGCTGGAGCCGGGAGTAATAGACGGGAGAAGGCTAGATCAAGATTTTGGCCTGGGGCG
TGGAGACAAACGAATGGGGAAAAACAGGTCGCGGTAGTACCTCGAAACGTGTTTGGGATACCTCTGGAAGAATCA
CTCGAGGTTTCGCAGATATGTAACTTGCCATCGATCGTCTTCAGGTCCATTGAATATTTGGAAGCGAAGAAAGCC
GATCAGGAGGAGGGTATCTATAGGTTGAGCGGGAGTTCTGCGGTTATCAAGAGTTTGAAAGATCGTTTCAATGCT
GAGGGTGATTTGAATTTGTTGGCTAGCGATGAATACTGGGACCCTCATGCTATTGCTGGCTTACTCAAGAGTTAC
TTGAGGGAGTTACCGGCGAGTATCCTGACAAGGGAGCTACATTTCAGGTTCCTGTCCGTTATCGACTTTGTTGAT
CCCCAGGAACGAATCCGAGAATTATCTCAACTCATTGCATCACTGCCAATCGCGAATTACAGTATTCTCCGTGCG
CTTACGGCTCATTTAATACTGATCGTACAAAATGCAAGTGTCAACAAAATGACGATGCGGAATGTCGGTATTGTC
TTTTCGCCGACATTGGGTATACCGGCAGGAGTCTTCAGCTTAATGCTTGGAGAGTTCAATCGAGTTTTTAATGTT
GATGCTGGTCGGGACCTTGACAATCATAGTGCGGTTGCGAGCGAAGATGGACTCGAACCATTACATGAAGAGGGA
GGGGACGATGTTTCGAAGAGGAATAGGAATAGCAGGCATTACTCTCATGCGGCCGCAGATCAGATTCTGGGACTC
GGAGGACGAAGCCTTAACACATCCGCGGATGACCCGCAATCGGACACGGATGATTACTCCGTACAAGATGAGAGT
GGGACCGAGACGACGGGTGATGGTGAGATGACAGCCGAATCGGTGTCGGGGTCAATCTCGACACCCAGCCGTGAT
CGAGATCATCAGGACTCCTTCCACCATCCACATCATCAGCAACAACAACAGCATACGATACGAATTAGTGGTCCC
CCTGACACTCCCGTAGCGGCAAGGATTTCAAAGGCGGCAAGTACGGCAAATAGCAAAGGCTTGAATTTGAATGCG
GTGGGTAAACGAGGAACGACGAGTGGCCTTGGTGGTGGTCTCATTGGATTACCTACGTCGCCCAGACCGATGCTT
TCGCCTTCAAGGGCGGACATTTCTGCACCACCACCACCACCGCAATCTTTTTTGGGATGA
Gene >AgabiH97|095000
ATGGCCACCCGCGACAGACTCGCTCCCCAGTCCCCGCTCCAGCCACAGCGCTCGTCCAGCTCGCCGTCGTCGTCC
ACCTCGGCCCTCCCCTCGTCGTCTACCTCGACTTCCCTCTCCCACTCCCAGCCTCTCTCCTCCACTTCTCTTCTC
AGGCAGCACGAAGCCGCCCCAGATTCAAAGCTCGCCGCCTTGGAACAGGCTGTCAACGAACGCAATGTCCTCGCC
GCTCAGAATACCCAGCTCTGGAAGCTCATCGAAAAGCAGCGGTCAGGCTACAATCAGATTATCAAAGAACTCGAC
AGAATCAGGGGCGAGCGTGATGCATACAAAGCAAAGGTAGTCGCCCTCGGTGGCTCCGCAGACAGAAAGAGCCAG
AAATCTGCAGATCGCAAGACGCGCACCGAGGTCGACTCTGGAGACGCCCCTTCACGACAACACTCGCAAGATAAT
AGTCTGTCGTCTTTTCTGATCCGACTTGCCTTTCTCACGTCTCTCCAGGTACTCCCCGACTACATTCCTCTCGCT
CGTACAACGAGTCTCTCCGCAACAACGACAGCACCTCATCCACGAGCATAAATTCCGGCACCCTGCCACCGCCAC
CACCCAGTGCCCCTGCCTCGTCCACCCCCACTTCTTCAAAGTACCAAAAATCTCTCCCAAATGCACCATCCCATT
CCGACTCCCAGTCACTTCCCGTATCCGCATCCGCATCCATTTCTTCAGATGAACCACCGCAGATTCGCAAAGGCA
GTATTGCCGAAAGCATCAGCAGCGTCAGTTCCAGCATGAACTATAATGCCTCCGCACTTACGACAGCCACATCCT
CGAGTATCCATTCTTCCTCTTCCCCATCCGCGAACGCTTCGTCTACTACGTCGGTACAGATCACTATGTCGCCCG
CCTCGCCCCAAACTCCCCGTGTTTCTCTCAGTCAGACATCAATCAAAGCCGAGGCGCGACCTATGCTTCCTCCAA
TGGACCCTCGTAGCTCCCGCATCACTCTTCCCGACGAAGCCAGGCAATATATTGTCAACATGGTTGACTCGCCCT
CTCCAAGTCCCAAGCTCGACTCTTTTTCTTCGTCCAAGCCCAAGGTTTCCTCCAATCTTGTTCCTCAGCAGCAAG
ACGACTCATCGAAACCCGAAGCCTCAGAATTCCTCGACCTGGAAGACGACGACGAGGATGCTGAGGATGTGGAAT
TGTACGATGACGAAGCTGAATTCAGAAGATCTGTTCATGATCAGAATCAAACCAAGGCCGCCGATTCGGCTGTTC
CGGATTCCAGAATTGATCACAGTACAACAACCCCGCCAGACCGGCAACCTCACTCTGACGCTCCCAACTTCACTA
ATCCATTCCATGACCCCCCAAATACTGGCCAAGATCCAAGCCAAGTAGGGGTCCCATCTGAGGATTTGTCCTCAA
CGTCCTCACAGCACTCGCTACCGCCGGAATTTGCGACTGATCAATCTACCGAAATGGATCAGGCTACACCCGGGC
CGCATCAGTTGCTCATCAACGATAATTCCGGTTCGTCGTCAATTGGACCTCCATCCCAACCCCATCATCAGTTTT
ATCATCATACGCCACTGCAACAACAGCCGCAACAGCAACAGCAAGTGGGACCCAGTCATTCGAATTATCCCTCAG
TTTCACTACCGTCAGCATATCTATCCCACCAGCAAATGAGCCAACAACAAATGATGCCCGTAGCTGCACCACCAC
GCACAGACTCTCGACCGGTCGTTGAGTCCACCTCAACGCTTAGCTCGCTCGAACCCCCTCCCACGCGCAAACGTG
ACAGAGAGCATTACCGGGCGCTACCCCTCCTGCCCACTGATTTACCGACCACCATTGTTTCGGTTTCTCACTCTT
CTGTTCGCCCTAACGACAGAGGCAAGGAGGTACTCTGGTTTGTGATTACCGTAAATCCAGGGAGTGGGAAGGAAC
CATGGAAAGTGGAGAAAAGGTATTCTGATGTGGTCACCCTGGATTCCAGGGTTCGGGCAAGTGTCGGCAAGTCTG
TTGCGAAGAAGATTACTGGTTTACCTGAGGGGAAATTTTGGAAGGATCATGCACCCGCAAAAGTTGACCAACGAA
AGGTGACTAATTTTTTTTTTTTTGATTTATTGCGCCGCATGTCACTCATTGTATGCACGATAGGCGCTACTGGAG
TCTTATCTCCAATCACTTCTGAAGTTGCCAATCAGACATAACGATGAGGCCATTGCATTCCTCACCACCGATATT
GTTCGCGAGACTCGTCAACCAGTCATGCAAGCAGGTCATAAAGAAGGATATTTGACGAAAAGGGGCAAAAACTTT
GGAGGGTGGAAAACGCGGTATTTTGTTCTACAAGGCCCCGTACTTGAATACTATGAATCCGTGCGCTTTATTCTA
ATTATCATAAAAACTACAAGACCTGACATATCCTCTTTTTGGGGTTAGCGTGGAGGTACGCACCTGGGTTCGATC
GTGATCACTGGTGCGCAAATTGGGCGCCAGCAACGTAACTCCGATAGGCAGAACTCCAACTCGAATCACAATAAC
CCTAATGGCGGCTCTAACTATCATGATGACGAGAAGGAGTATCGTCACGCTTTTCTAATTGTTGAAGCCAAAAAG
GGACCTGGAGGTTCACACCCAAGGCACGTGCTGTGCGCTGAGAGTGATGAAGAGAGAGACGCTTGGGTTGAGATG
CTCGTGCGGTACTTTACTGGTGTATACAGTGAGGAACCATTGAATTATGGCGCTCCTCCTCCCCCTGTCGCCTCC
TCCTCTCATCACCTTGTGAAGCAACCACAAAGAGGGCTATCGAAAGACGAGATCTTGGTTTCGAAAGGCGTTCCA
CTTTCACAACTCCAACAAGACCCGAGCAATGCGAAATTATTCTCGACACCGCATAACGTGGACGAGATTAATAAT
CTGGAACGACCTGGGAGTCCCGTCAAATCCCTGGATCAATTATCTATTGAACGACAGATTTCACAAGGTGGCGGA
CAAAATAGCAAATCTGCGAGTAATGATACTGCGAAGAGGGTTTTGGAGAGACTTCAAGGTCTTCCTTCGAGTTTA
CCTGATGCACCGTCAATGCTTTCTGGCGTTGGCAACGTTGAGGTTGTGGGTGGTCCTCGACCGAATTCGGAAATG
GGCCATTACGGTCGTGACGGTATGACAGAGATGATGGATAAGAGGAAATCTTCAAGGAATCATTCACCTGAAAGG
TATCGATATGATGTTCGAAAGACTTCTCTTTATCCTTCAAATAGCAGCAACAACAATTCGAGCTCGAATTCGAAC
TCGAATCTCAGCACTCCCGGATCTAATAACATGAACAGATCTCCATCACCCGATAAGATGGACGGTGGTGGTGGT
GCAAGTACTACGAAGCCGAAAATTTCAGCGCCGATGGGCGGACAACCTATTCCTTCTGGATTTAAATGGGGTGGG
GGAGAGAGTAATGTTGGAGGATCGGGAGGTGATGGTGGTGCTGGAGCCGGGAGTAATAGACGGGAGAAGGCTAGA
TCAAGATTTTGGCCTGGGGCGTGGAGACAAACGAATGGTTTGTTTTTTTTCCCTCTTCCATTGCAATGATATGGA
GAATGCTAAATATATAACTTTTATTAATCTTCAGGGGAAAAACAGGTCGCGGTAGTACCTCGAAACGTGTTTGGG
ATACCTCTGGAAGAATCACTCGAGGTTTCGCAGATATGTAACTTGCCATCGATCGTCTTCAGGTCCATTGAATAT
TTGGAAGCGAAGAAAGCCGATCAGGAGGAGGGTATCTATAGGTTGAGCGGGAGTTCTGCGGTTATCAAGAGTTTG
AAAGATCGTTTCAATGCTGGTGCGTAGCATATCATTTACTTGGCTTTCTTTGTGCCACGTTGTTGACTGATATCT
GTTTAGAGGGTGATTTGAATTTGTTGGCTAGCGATGAATACTGGGACCCTCATGCTATTGCTGGCTTACTCAAGA
GTTACTTGAGGGAGTTACCGGCGAGTATCCTGACAAGGGAGCTACATTTCAGGTTCCTGTCCGTTATCGGTATGC
CCTATCAAAGTGTCCCTAAGTGTTTTTTTTTCTGACTCTGTCAATTTTTTTTTTCCTTTTTGATTCAGACTTTGT
TGATCCCCAGGAACGAATCCGAGAATTATCTCAACTCATTGCATCACTGCCAATCGCGAATTACAGTATTCTCCG
TGCGCTTACGGCTCATTTAATACTGATCGTACAAAATGCAAGTGTCAACAAAATGACGATGCGGAATGTCGGTAT
TGTCTTTTCGCCGACATTGGGTATACCGGCAGGAGTCTTCAGCTTAATGCTTGGAGAGTTCAATCGAGTTTTTAA
TGTTGATGCTGGTCGGGACCTTGACAATCATAGTGCGGTTGCGAGCGAAGATGGACTCGAACCATTACATGAAGA
GGGAGGGGACGATGTTTCGAAGAGGAATAGGAATAGCAGGCATTACTCTCATGCGGCCGCAGATCAGATTCTGGG
ACTCGGAGGACGAAGCCTTAACAGTGAGTAATTCTAATCGTTTGGAGTTATTTTAGACGCTCGGGCGCTGACCGA
GACTTCTCTTTGTGCCTTCTTTCCCTTCGTTGCCTCGGCTCCCCTTCCTGCCTTTCCTATCCTTAATTTAGCATC
CGCGGATGACCCGCAATCGGACACGGATGATTACTCCGTACAAGATGAGAGTGGGACCGAGACGACGGGTGATGG
TGAGATGACAGCCGAATCGGTGTCGGGGTCAATCTCGACACCCAGCCGTGATCGAGATCATCAGGACTCCTTCCA
CCATCCACATCATCAGCAACAACAACAGCATACGATACGAATTAGTGGTCCCCCTGACACTCCCGTAGCGGCAAG
GATTTCAAAGGCGGCAAGTACGGCAAATAGCAAAGGCTTGAATTTGAATGCGGTGGGTAAACGAGGAACGACGAG
TGGCCTTGGTGGTGGTCTCATTGGATTACCTACGTCGCCCAGACCGATGCTTTCGCCTTCAAGGGCGGACATTTC
TGCACCACCACCACCACCGCAATCTTTTTTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail