Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094790
Gene name
Locationscaffold_6:1675852..1678683
Strand-
Gene length (bp)2831
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 2.5E-16 662 724
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.8E-03 492 509
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 4.2E-01 515 534

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 486 534 3.0E-09
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 486 534 3.0E-09
sp|Q8N5P1|ZC3H8_HUMAN Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens GN=ZC3H8 PE=1 SV=2 465 535 1.0E-07
sp|Q9JJ48|ZC3H8_MOUSE Zinc finger CCCH domain-containing protein 8 OS=Mus musculus GN=Zc3h8 PE=1 SV=2 487 534 1.0E-07
sp|A6NMK7|CPS4L_HUMAN Putative cleavage and polyadenylation specificity factor subunit 4-like protein OS=Homo sapiens GN=CPSF4L PE=2 SV=3 486 535 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094790
MATLAVPSSYTPLFPTETPHAHDSATLKFPHTRAQLAAVARQHKPADTHDSDTGTDDLGRVPSSFVAKVVSLLTD
EKEDELKALLKATYSLDNQSLEESVLDLMHKHRDDVAGVPFVFLTPTRRPISRPSSRASSHSARLHPARPDTPSS
APPSPLAWSHRRPHTPATSPLANGEPRSYMSPKSDYSPSSSPILAHAQATQAQAQWTASLPASPLLTSRSLNAKA
SEFRPIPRPLSSASSQPGSLLRADTPSPDMWAHNSPRATSNLAIAAPLIADQSTSAPRALTPSSSLRSFVRPDED
EDEGEDPDPYDPFTNNGQLPAPFHSITVSDFDNQWSVSPPEESELTHMATQPPYEYGYSPFNPNGNNDPIDDVEA
NAALTDGMTPFDVLSSVFGSTLAPSELEEALAANGYDFEHAMAWLIDRGLPQQPASPTQVRMQPMGNRVTLVSRD
TGGTIRGTVKGGYHNNNSNGTGRGAPPRYANGRPSQSGNRVCRYFVAGECLRADCRFSHDLERALCRFWLRGMCA
KNEACEFLHHLPKDVDVANLNVAMSRANIGPPSHYGPPEMHAPVDEFPVLGYEGNVMRMNKPGGYYDPGRTRFAA
AVKKPAPPKINGVQLARVMGPAADNLHHQSAIVAPRPSPRIKLHPPTLVPTLPTGDAVNQLYMNYRQRALQLGAA
RNACLSRAADAWRRGDGAAAKRFSREGHDLNAKMSTEMANAASKLVRERSSLAEQAVRARDLSWSDDPGDRSARG
RPCGSGLGVVLGVGRKDVGDGKLTTEERTECMLDLHGLHSNEATEVLEQFLLSLEREHFYGLAYAVVGEEKHTGT
QDPSRGASRNRLATAVREWVHRWGYPWSERDGIICIDPLTHASE*
Coding >AgabiH97|094790
ATGGCTACCCTCGCCGTCCCTTCCTCTTACACGCCCCTCTTTCCGACAGAGACACCACACGCACACGACTCTGCC
ACCCTCAAGTTTCCCCACACAAGAGCTCAGCTCGCCGCCGTCGCGCGCCAACACAAACCAGCCGACACTCATGAT
TCAGACACCGGCACAGACGACCTCGGCCGCGTTCCGTCTTCCTTTGTCGCAAAGGTCGTTTCTCTGCTCACAGAC
GAAAAGGAAGACGAGCTCAAGGCGCTGCTCAAGGCCACCTACAGTCTAGACAATCAATCACTCGAAGAGTCTGTG
CTGGACCTCATGCACAAGCACCGCGACGACGTCGCTGGCGTCCCATTTGTATTTTTGACGCCAACGCGTCGTCCC
ATTTCCCGTCCTTCTTCCCGGGCGTCATCTCACTCGGCCCGTCTCCACCCTGCACGCCCAGACACGCCCTCTTCC
GCCCCACCTTCTCCCCTTGCCTGGTCACATCGTCGCCCTCACACCCCTGCCACCTCCCCACTCGCAAACGGCGAG
CCAAGGTCATACATGTCCCCAAAGAGCGATTATTCTCCCTCATCGTCCCCTATCTTGGCCCACGCTCAAGCCACT
CAAGCACAGGCCCAATGGACTGCCAGTCTTCCAGCCTCTCCTTTGCTCACCTCTCGTTCTCTCAATGCCAAAGCT
TCAGAATTCAGACCCATCCCAAGGCCGCTTTCTTCAGCTTCTTCTCAACCTGGCTCACTTCTTCGTGCCGACACG
CCTTCTCCAGACATGTGGGCTCACAACTCCCCACGCGCCACCTCCAATCTCGCCATCGCCGCGCCACTCATAGCA
GATCAGTCCACTTCCGCTCCAAGGGCACTCACCCCCAGCTCATCTTTGCGCTCCTTTGTCCGCCCCGATGAAGAC
GAAGACGAAGGCGAAGATCCCGATCCCTATGATCCCTTCACTAACAATGGCCAGCTGCCAGCCCCGTTCCATTCC
ATTACCGTTTCCGACTTTGATAATCAGTGGTCCGTATCACCGCCAGAAGAGTCAGAGCTCACTCATATGGCAACT
CAACCTCCATACGAGTACGGCTATTCGCCGTTCAACCCGAATGGAAACAATGATCCCATCGACGATGTTGAAGCC
AACGCCGCTCTCACAGATGGCATGACGCCCTTTGATGTTCTCAGTTCCGTCTTTGGCTCTACACTAGCCCCATCA
GAGCTCGAAGAGGCTCTGGCCGCCAATGGATACGATTTCGAGCACGCGATGGCGTGGTTGATCGATCGTGGTTTA
CCTCAACAGCCAGCGTCGCCTACACAAGTACGAATGCAGCCTATGGGCAATCGTGTCACTCTGGTATCACGCGAT
ACCGGGGGAACCATACGTGGCACTGTCAAAGGCGGATATCACAACAACAATAGCAATGGGACCGGTCGTGGTGCT
CCTCCGAGATATGCCAATGGCCGCCCTTCCCAATCGGGTAATAGGGTCTGCAGATATTTTGTTGCTGGAGAATGC
CTCCGCGCGGACTGCCGTTTCAGTCATGACTTGGAGCGCGCCTTGTGTCGCTTTTGGTTGAGAGGTATGTGTGCT
AAAAATGAAGCTTGCGAGTTTTTGCACCATTTGCCCAAGGATGTGGATGTGGCAAACTTGAACGTGGCGATGTCC
CGAGCGAATATAGGACCACCCAGTCACTATGGTCCACCCGAGATGCACGCTCCCGTTGACGAGTTCCCTGTACTT
GGGTATGAGGGAAATGTTATGAGGATGAATAAACCTGGAGGATATTATGATCCGGGACGAACACGATTCGCAGCT
GCTGTCAAGAAACCAGCTCCTCCCAAGATTAATGGCGTTCAACTGGCTCGTGTGATGGGCCCGGCCGCGGATAAT
TTGCATCACCAATCGGCTATTGTTGCTCCTCGACCGTCGCCACGTATAAAACTTCATCCACCTACCTTGGTACCG
ACTTTACCTACCGGTGATGCTGTCAATCAGTTATACATGAATTATCGTCAACGTGCGTTACAGTTGGGAGCGGCA
AGGAATGCTTGTTTGTCTCGTGCTGCTGATGCATGGAGACGAGGAGATGGCGCTGCTGCCAAGAGGTTTAGTAGG
GAAGGACATGATCTGAATGCCAAAATGTCAACGGAGATGGCGAATGCGGCATCTAAATTAGTTAGGGAACGATCG
AGTTTGGCGGAACAGGCTGTGAGGGCGAGAGATTTAAGTTGGTCGGATGATCCTGGGGACCGGAGTGCGAGGGGG
AGACCTTGTGGGTCTGGTTTGGGTGTTGTTTTGGGTGTGGGGAGGAAGGATGTTGGAGATGGCAAGTTGACGACG
GAGGAGAGGACGGAGTGTATGCTTGATTTACATGGTTTGCATTCGAATGAGGCTACGGAGGTGTTGGAACAATTT
TTACTTTCGTTGGAAAGGGAACACTTTTATGGTTTAGCTTATGCGGTTGTTGGAGAAGAAAAGCATACTGGGACG
CAAGATCCTTCTAGGGGCGCTTCGCGTAATAGATTGGCTACGGCTGTACGTGAATGGGTTCATCGTTGGGGATAT
CCATGGAGCGAGAGAGATGGTATCATTTGCATTGATCCATTGACCCACGCGTCCGAGTAG
Transcript >AgabiH97|094790
ATGGCTACCCTCGCCGTCCCTTCCTCTTACACGCCCCTCTTTCCGACAGAGACACCACACGCACACGACTCTGCC
ACCCTCAAGTTTCCCCACACAAGAGCTCAGCTCGCCGCCGTCGCGCGCCAACACAAACCAGCCGACACTCATGAT
TCAGACACCGGCACAGACGACCTCGGCCGCGTTCCGTCTTCCTTTGTCGCAAAGGTCGTTTCTCTGCTCACAGAC
GAAAAGGAAGACGAGCTCAAGGCGCTGCTCAAGGCCACCTACAGTCTAGACAATCAATCACTCGAAGAGTCTGTG
CTGGACCTCATGCACAAGCACCGCGACGACGTCGCTGGCGTCCCATTTGTATTTTTGACGCCAACGCGTCGTCCC
ATTTCCCGTCCTTCTTCCCGGGCGTCATCTCACTCGGCCCGTCTCCACCCTGCACGCCCAGACACGCCCTCTTCC
GCCCCACCTTCTCCCCTTGCCTGGTCACATCGTCGCCCTCACACCCCTGCCACCTCCCCACTCGCAAACGGCGAG
CCAAGGTCATACATGTCCCCAAAGAGCGATTATTCTCCCTCATCGTCCCCTATCTTGGCCCACGCTCAAGCCACT
CAAGCACAGGCCCAATGGACTGCCAGTCTTCCAGCCTCTCCTTTGCTCACCTCTCGTTCTCTCAATGCCAAAGCT
TCAGAATTCAGACCCATCCCAAGGCCGCTTTCTTCAGCTTCTTCTCAACCTGGCTCACTTCTTCGTGCCGACACG
CCTTCTCCAGACATGTGGGCTCACAACTCCCCACGCGCCACCTCCAATCTCGCCATCGCCGCGCCACTCATAGCA
GATCAGTCCACTTCCGCTCCAAGGGCACTCACCCCCAGCTCATCTTTGCGCTCCTTTGTCCGCCCCGATGAAGAC
GAAGACGAAGGCGAAGATCCCGATCCCTATGATCCCTTCACTAACAATGGCCAGCTGCCAGCCCCGTTCCATTCC
ATTACCGTTTCCGACTTTGATAATCAGTGGTCCGTATCACCGCCAGAAGAGTCAGAGCTCACTCATATGGCAACT
CAACCTCCATACGAGTACGGCTATTCGCCGTTCAACCCGAATGGAAACAATGATCCCATCGACGATGTTGAAGCC
AACGCCGCTCTCACAGATGGCATGACGCCCTTTGATGTTCTCAGTTCCGTCTTTGGCTCTACACTAGCCCCATCA
GAGCTCGAAGAGGCTCTGGCCGCCAATGGATACGATTTCGAGCACGCGATGGCGTGGTTGATCGATCGTGGTTTA
CCTCAACAGCCAGCGTCGCCTACACAAGTACGAATGCAGCCTATGGGCAATCGTGTCACTCTGGTATCACGCGAT
ACCGGGGGAACCATACGTGGCACTGTCAAAGGCGGATATCACAACAACAATAGCAATGGGACCGGTCGTGGTGCT
CCTCCGAGATATGCCAATGGCCGCCCTTCCCAATCGGGTAATAGGGTCTGCAGATATTTTGTTGCTGGAGAATGC
CTCCGCGCGGACTGCCGTTTCAGTCATGACTTGGAGCGCGCCTTGTGTCGCTTTTGGTTGAGAGGTATGTGTGCT
AAAAATGAAGCTTGCGAGTTTTTGCACCATTTGCCCAAGGATGTGGATGTGGCAAACTTGAACGTGGCGATGTCC
CGAGCGAATATAGGACCACCCAGTCACTATGGTCCACCCGAGATGCACGCTCCCGTTGACGAGTTCCCTGTACTT
GGGTATGAGGGAAATGTTATGAGGATGAATAAACCTGGAGGATATTATGATCCGGGACGAACACGATTCGCAGCT
GCTGTCAAGAAACCAGCTCCTCCCAAGATTAATGGCGTTCAACTGGCTCGTGTGATGGGCCCGGCCGCGGATAAT
TTGCATCACCAATCGGCTATTGTTGCTCCTCGACCGTCGCCACGTATAAAACTTCATCCACCTACCTTGGTACCG
ACTTTACCTACCGGTGATGCTGTCAATCAGTTATACATGAATTATCGTCAACGTGCGTTACAGTTGGGAGCGGCA
AGGAATGCTTGTTTGTCTCGTGCTGCTGATGCATGGAGACGAGGAGATGGCGCTGCTGCCAAGAGGTTTAGTAGG
GAAGGACATGATCTGAATGCCAAAATGTCAACGGAGATGGCGAATGCGGCATCTAAATTAGTTAGGGAACGATCG
AGTTTGGCGGAACAGGCTGTGAGGGCGAGAGATTTAAGTTGGTCGGATGATCCTGGGGACCGGAGTGCGAGGGGG
AGACCTTGTGGGTCTGGTTTGGGTGTTGTTTTGGGTGTGGGGAGGAAGGATGTTGGAGATGGCAAGTTGACGACG
GAGGAGAGGACGGAGTGTATGCTTGATTTACATGGTTTGCATTCGAATGAGGCTACGGAGGTGTTGGAACAATTT
TTACTTTCGTTGGAAAGGGAACACTTTTATGGTTTAGCTTATGCGGTTGTTGGAGAAGAAAAGCATACTGGGACG
CAAGATCCTTCTAGGGGCGCTTCGCGTAATAGATTGGCTACGGCTGTACGTGAATGGGTTCATCGTTGGGGATAT
CCATGGAGCGAGAGAGATGGTATCATTTGCATTGATCCATTGACCCACGCGTCCGAGTAG
Gene >AgabiH97|094790
ATGGCTACCCTCGCCGTCCCTTCCTCTTACACGCCCCTCTTTCCGACAGAGACACCACACGCACACGACTCTGCC
ACCCTCAAGTTTCCCCACACAAGAGCTCAGCTCGCCGCCGTCGCGCGCCAACACAAACCAGCCGACACTCATGAT
TCAGACACCGGCACAGACGACCTCGGCCGCGTTCCGTCTTCCTTTGTCGCAAAGGTCGTTTCTCTGCTCACAGAC
GAAAAGGAAGACGAGCTCAAGGCGCTGCTCAAGGCCACCTACAGTCTAGACAATCAATCAGTCAGTATCTCCACG
TAGGCCTAAACATTGTGTCCTGAACAGATATTCAACAGCTCGAAGAGTCTGTGCTGGACCTCATGCACAAGCACC
GCGACGACGTCGCTGGCGTCCCATTTGTATTTTTGACGCCAACGCGTCGTCCCATTTCCCGTCCTTCTTCCCGGG
CGTCATCTCACTCGGCCCGTCTCCACCCTGCACGCCCAGACACGCCCTCTTCCGCCCCACCTTCTCCCCTTGCCT
GGTCACATCGTCGCCCTCACACCCCTGCCACCTCCCCACTCGCAAACGGCGAGCCAAGGTCATACATGTCCCCAA
AGAGCGATTATTCTCCCTCATCGTCCCCTATCTTGGCCCACGCTCAAGCCACTCAAGCACAGGCCCAATGGACTG
CCAGTCTTCCAGCCTCTCCTTTGCTCACCTCTCGTTCTCTCAATGCCAAAGCTTCAGAATTCAGACCCATCCCAA
GGCCGCTTTCTTCAGCTTCTTCTCAACCTGGCTCACTTCTTCGTGCCGACACGCCTTCTCCAGACATGTGGGCTC
ACAACTCCCCACGCGCCACCTCCAATCTCGCCATCGCCGCGCCACTCATAGCAGATCAGTCCACTTCCGCTCCAA
GGGCACTCACCCCCAGCTCATCTTTGCGCTCCTTTGTCCGCCCCGATGAAGACGAAGACGAAGGCGAAGATCCCG
ATCCCTATGATCCCTTCACTAACAATGGCCAGCTGCCAGCCCCGTTCCATTCCATTACCGTTTCCGACTTTGATA
ATCAGTGGTCCGTATCACCGCCAGAAGAGTCAGAGCTCACTCATATGGCAACTCAACCTCCATACGAGTACGGCT
ATTCGCCGTTCAACCCGAATGGAAACAATGATCCCATCGACGATGTTGAAGCCAACGCCGCTCTCACAGATGGCA
TGACGCCCTTTGATGTTCTCAGTTCCGTCTTTGGCTCTACACTAGCCCCATCAGAGCTCGAAGAGGCTCTGGCCG
CCAATGGATACGATTTCGAGCACGCGATGGCGTGGTTGATCGATCGTGGTTTACCTCAACAGCCAGCGTCGCCTA
CACAAGTACGAATGCAGCCTATGGGCAATCGTGTCACTCTGGTATCACGCGATACCGGGGGAACCATACGTGGCA
CTGTCAAAGGCGGATATCACAACAACAATAGCAATGGGACCGGTCGTGGTGCTCCTCCGAGATATGCCAATGGCC
GCCCTTCCCAATCGGGTAATAGGGTCTGCAGATATTTTGTTGCTGGAGAATGCCTCCGCGCGGACTGCCGTTTCA
GGTTGGTTTGCCGTCTCCATACTCTACATGTGCGCTGATGCATTTCTATATAGTCATGACTTGGAGCGCGCCTTG
TGTCGCTTTTGGTTGAGAGGTATGTGTGCTAAAAATGAAGCTTGCGAGTTTTTGCACCATTTGCCCAAGGATGTG
GATGTGGCAAACTTGAACGTGGCGATGTCCCGAGCGAATATAGGACCACCCAGTCACTATGGTCCACCCGAGATG
CACGCTCCCGTTGACGAGTTCCCTGTACTTGGGTATGAGGGAAATGTTATGAGGATGAATAAACCTGGAGGATAT
TATGATCCGGGACGAACACGATTCGCAGCTGCTGTCAAGAAACCAGCTCCTCCCAAGATTAATGGCGTTCAACTG
GCTCGTGTGATGGGCCCGGCCGCGGATAATTTGCATCACCAATCGGCTATTGTTGCTCCTCGACCGTCGCCACGT
ATAAAACTTCATCCACCTACCTTGGTACCGACTTTACCTACCGGTGATGCTGTCAATCAGTTATACATGAATTAT
CGTCAACGTGCGTTACAGTTGGGAGCGGCAAGGAATGCTTGTTTGTCTCGTGCTGCTGATGCATGGAGACGAGGA
GATGGCGCTGCTGCCAAGAGGTTTAGTAGGGAAGGACATGATCTGAATGCCAAAATGTCAACGGAGATGGCGAAT
GCGGCATCTAAATTAGTTAGGGAACGATCGAGTTTGGCGGAACAGGCTGTGAGGGCGAGAGATTTAAGTTGGTCG
GATGATCCTGGGGACCGGAGTGCGAGGGGGAGACCTTGTGGGTCTGGTTTGGGTGTTGTTTTGGGTGTGGGGAGG
AAGGATGTTGGAGATGGCAAGTTGACGACGGAGGAGAGGACGGAGTGTATGCTTGATTTACATGGTTTGCATTCG
AATGAGGCTACGGAGGTGTTGGAACAATTTTTACTTTCGGTGAGATTTCTATCATTATCAATTCGTTTCATGTGC
GGGTGTTAATCATCTTGTAGTTGGAAAGGGAACACTTTTATGGTTTAGGTACGTTGTTACATGAACTGTTCAATT
GAGAGACATGACACTGATGGATTTTGTTGCTAGCTTATGCGGTTGTTGGAGAAGAAAAGCATACTGGGACGCAAG
ATCCTTCTAGGGGCGCTTCGCGTAATAGATTGGCTACGGCTGTACGTGAATGGGTTCATCGTTGGGGATATCCAT
GGAGCGAGAGAGATGGTATCATTTGCATTGATCCATTGACCCACGCGTCCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail