Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094740
Gene name
Locationscaffold_6:1656020..1660864
Strand-
Gene length (bp)4844
Transcript length (bp)4398
Coding sequence length (bp)4398
Protein length (aa) 1466

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain 1.9E-45 1049 1206
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 1.9E-16 954 1012
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 4.9E-14 1229 1296
PF00258 Flavodoxin_1 Flavodoxin 8.8E-26 723 868

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1K9C2|MET5_SCHPO Sulfite reductase [NADPH] subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir1 PE=3 SV=1 6 1445 0.0E+00
sp|P47169|MET5_YEAST Sulfite reductase [NADPH] subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET5 PE=1 SV=1 257 1448 0.0E+00
sp|B7GJU8|CYSI_ANOFW Sulfite reductase [NADPH] hemoprotein beta-component OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysI PE=3 SV=1 890 1448 0.0E+00
sp|A4IMT6|CYSI_GEOTN Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysI PE=3 SV=1 890 1448 0.0E+00
sp|O32213|CYSI_BACSU Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus subtilis (strain 168) GN=cysI PE=1 SV=1 890 1448 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1K9C2|MET5_SCHPO Sulfite reductase [NADPH] subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir1 PE=3 SV=1 6 1445 0.0E+00
sp|P47169|MET5_YEAST Sulfite reductase [NADPH] subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET5 PE=1 SV=1 257 1448 0.0E+00
sp|B7GJU8|CYSI_ANOFW Sulfite reductase [NADPH] hemoprotein beta-component OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysI PE=3 SV=1 890 1448 0.0E+00
sp|A4IMT6|CYSI_GEOTN Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysI PE=3 SV=1 890 1448 0.0E+00
sp|O32213|CYSI_BACSU Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus subtilis (strain 168) GN=cysI PE=1 SV=1 890 1448 0.0E+00
sp|A7Z8R5|CYSI_BACMF Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysI PE=3 SV=1 887 1448 0.0E+00
sp|Q9KF75|CYSI_BACHD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysI PE=3 SV=1 876 1448 0.0E+00
sp|Q3JBJ1|CYSI_NITOC Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysI PE=3 SV=1 894 1448 0.0E+00
sp|Q5L041|CYSI_GEOKA Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus kaustophilus (strain HTA426) GN=cysI PE=3 SV=1 880 1448 0.0E+00
sp|C0Z9X2|CYSI_BREBN Sulfite reductase [NADPH] hemoprotein beta-component OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysI PE=3 SV=1 894 1443 0.0E+00
sp|Q65L57|CYSI_BACLD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysI PE=3 SV=1 876 1448 0.0E+00
sp|B1HXC1|CYSI_LYSSC Sulfite reductase [NADPH] hemoprotein beta-component OS=Lysinibacillus sphaericus (strain C3-41) GN=cysI PE=3 SV=1 889 1447 0.0E+00
sp|A8FDY3|CYSI_BACP2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus pumilus (strain SAFR-032) GN=cysI PE=3 SV=1 883 1447 0.0E+00
sp|B8IRY2|CYSI_METNO Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|Q8EQP0|CYSI_OCEIH Sulfite reductase [NADPH] hemoprotein beta-component OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysI PE=3 SV=1 894 1443 0.0E+00
sp|Q5WKE7|CYSI_BACSK Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus clausii (strain KSM-K16) GN=cysI PE=3 SV=1 890 1443 0.0E+00
sp|Q1QU16|CYSI_CHRSD Sulfite reductase [NADPH] hemoprotein beta-component OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysI PE=3 SV=1 893 1447 0.0E+00
sp|B0U8Y9|CYSI_METS4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium sp. (strain 4-46) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|Q1D9W9|CYSI_MYXXD Sulfite reductase [NADPH] hemoprotein beta-component OS=Myxococcus xanthus (strain DK 1622) GN=cysI PE=3 SV=1 887 1437 0.0E+00
sp|Q4L9F1|CYSI_STAHJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysI PE=3 SV=1 894 1447 0.0E+00
sp|B9DLM4|CYSI_STACT Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus carnosus (strain TM300) GN=cysI PE=3 SV=1 894 1446 0.0E+00
sp|Q49UL9|CYSI_STAS1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysI PE=3 SV=1 894 1447 0.0E+00
sp|B1LS97|CYSI_METRJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|C5APZ1|CYSI_METEA Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|B7L0Y4|CYSI_METC4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|A9W4X6|CYSI_METEP Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain PA1) GN=cysI PE=3 SV=2 893 1451 0.0E+00
sp|Q8CMX5|CYSI_STAES Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysI PE=3 SV=1 894 1447 0.0E+00
sp|Q5HKZ7|CYSI_STAEQ Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysI PE=3 SV=1 894 1447 0.0E+00
sp|B1Z7C5|CYSI_METPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysI PE=3 SV=1 893 1451 0.0E+00
sp|C6CXN6|CYSI_PAESJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Paenibacillus sp. (strain JDR-2) GN=cysI PE=3 SV=1 890 1448 0.0E+00
sp|Q1QQC7|CYSI_NITHX Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysI PE=3 SV=1 893 1448 0.0E+00
sp|A9IT77|CYSI_BORPD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=cysI PE=3 SV=1 882 1449 0.0E+00
sp|B6JCW3|CYSI_OLICO Sulfite reductase [NADPH] hemoprotein beta-component OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysI PE=3 SV=1 893 1448 0.0E+00
sp|Q0HYB3|CYSI_SHESR Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain MR-7) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|Q0HFL7|CYSI_SHESM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain MR-4) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A0KTH5|CYSI_SHESA Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain ANA-3) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|Q3SV33|CYSI_NITWN Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysI PE=3 SV=1 893 1448 0.0E+00
sp|Q8EB00|CYSI_SHEON Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella oneidensis (strain MR-1) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A9L2P8|CYSI_SHEB9 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS195) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A6WJT5|CYSI_SHEB8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS185) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A3D829|CYSI_SHEB5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A1RGD7|CYSI_SHESW Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain W3-18-1) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|A4Y9Z3|CYSI_SHEPC Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|Q12QQ5|CYSI_SHEDO Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysI PE=3 SV=1 886 1442 0.0E+00
sp|B8EE51|CYSI_SHEB2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS223) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|B8EKI5|CYSI_METSB Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=cysI PE=3 SV=1 893 1448 0.0E+00
sp|B0TTE4|CYSI_SHEHH Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysI PE=3 SV=1 886 1442 0.0E+00
sp|B8CJV9|CYSI_SHEPW Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysI PE=3 SV=1 886 1437 0.0E+00
sp|Q07Y86|CYSI_SHEFN Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysI PE=3 SV=1 886 1442 0.0E+00
sp|A8FZY7|CYSI_SHESH Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sediminis (strain HAW-EB3) GN=cysI PE=3 SV=2 883 1437 0.0E+00
sp|A8H094|CYSI_SHEPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysI PE=3 SV=1 886 1438 0.0E+00
sp|A3QAP0|CYSI_SHELP Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysI PE=3 SV=1 892 1437 0.0E+00
sp|B1KE86|CYSI_SHEWM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysI PE=3 SV=2 885 1438 0.0E+00
sp|B4RYS6|CYSI_ALTMD Sulfite reductase [NADPH] hemoprotein beta-component OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysI1 PE=3 SV=1 893 1449 0.0E+00
sp|Q0AGU3|CYSI_NITEC Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosomonas eutropha (strain C91) GN=cysI PE=3 SV=1 893 1444 0.0E+00
sp|Q8KQT8|CYSI_XANOR Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysI PE=1 SV=2 894 1438 0.0E+00
sp|B2SI05|CYSI_XANOP Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|Q2P0H2|CYSI_XANOM Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysI PE=3 SV=2 894 1438 0.0E+00
sp|Q82W45|CYSI_NITEU Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysI PE=3 SV=1 893 1444 0.0E+00
sp|Q3BPY4|CYSI_XANC5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysI PE=3 SV=2 894 1438 0.0E+00
sp|Q8PHC8|CYSI_XANAC Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|Q87L91|CYSI_VIBPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|Q32CG4|CYSI_SHIDS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B7NTA0|CYSI_ECO7I Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|Q8Z459|CYSI_SALTI Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella typhi GN=cysI PE=3 SV=3 894 1439 0.0E+00
sp|B1LQ86|CYSI_ECOSM Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q47UW8|CYSI_COLP3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysI PE=3 SV=1 887 1437 0.0E+00
sp|B4T474|CYSI_SALNS Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella newport (strain SL254) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B4TFY4|CYSI_SALHS Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella heidelberg (strain SL476) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B5QW35|CYSI_SALEP Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella enteritidis PT4 (strain P125109) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A8A3P4|CYSI_ECOHS Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O9:H4 (strain HS) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q8FEI8|CYSI_ECOL6 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysI PE=3 SV=3 883 1439 0.0E+00
sp|B0U6W0|CYSI_XYLFM Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain M12) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|Q3YY95|CYSI_SHISS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella sonnei (strain Ss046) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|Q0T1I7|CYSI_SHIF8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q31XM5|CYSI_SHIBS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q57KH8|CYSI_SALCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysI PE=3 SV=3 883 1439 0.0E+00
sp|B2TZH1|CYSI_SHIB3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B5FTU2|CYSI_SALDC Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella dublin (strain CT_02021853) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A9MF17|CYSI_SALAR Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q1R7T5|CYSI_ECOUT Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B6I6F7|CYSI_ECOSE Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain SE11) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B7N6Z7|CYSI_ECOLU Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|Q0TEA3|CYSI_ECOL5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A1AEU9|CYSI_ECOK1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O1:K1 / APEC GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B7LXH6|CYSI_ECO8A Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O8 (strain IAI1) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B7MYR1|CYSI_ECO81 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O81 (strain ED1a) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B5Z3C6|CYSI_ECO5E Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|Q8X7U2|CYSI_ECO57 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O157:H7 GN=cysI PE=3 SV=3 894 1439 0.0E+00
sp|B7LEI2|CYSI_ECO55 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain 55989 / EAEC) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B7MKN0|CYSI_ECO45 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A7ZQK6|CYSI_ECO24 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|Q7MHA6|CYSI_VIBVY Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio vulnificus (strain YJ016) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|Q83QE0|CYSI_SHIFL Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella flexneri GN=cysI PE=3 SV=3 883 1439 0.0E+00
sp|C0PXC5|CYSI_SALPC Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi C (strain RKS4594) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B7LWN9|CYSI_ESCF3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B0RPG6|CYSI_XANCB Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain B100) GN=cysI PE=3 SV=2 894 1438 0.0E+00
sp|Q4UY08|CYSI_XANC8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|A0KNL0|CYSI_AERHH Sulfite reductase [NADPH] hemoprotein beta-component OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysI PE=3 SV=1 893 1442 0.0E+00
sp|P17845|CYSI_SALTY Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysI PE=3 SV=3 883 1439 0.0E+00
sp|B4TTX8|CYSI_SALSV Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella schwarzengrund (strain CVM19633) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B5F430|CYSI_SALA4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella agona (strain SL483) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A6TD48|CYSI_KLEP7 Sulfite reductase [NADPH] hemoprotein beta-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q8DCK1|CYSI_VIBVU Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio vulnificus (strain CMCP6) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|A5F3I5|CYSI_VIBC3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|B5RDS0|CYSI_SALG2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B5XV25|CYSI1_KLEP3 Sulfite reductase [NADPH] hemoprotein beta-component 1 OS=Klebsiella pneumoniae (strain 342) GN=cysI1 PE=3 SV=1 883 1439 0.0E+00
sp|Q87DH0|CYSI_XYLFT Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysI PE=3 SV=2 894 1438 0.0E+00
sp|B2IA31|CYSI_XYLF2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain M23) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|Q8P608|CYSI_XANCP Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysI PE=3 SV=1 894 1438 0.0E+00
sp|A9N2E5|CYSI_SALPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|P17846|CYSI_ECOLI Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain K12) GN=cysI PE=1 SV=4 894 1439 0.0E+00
sp|B1IU78|CYSI_ECOLC Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|C4ZZR7|CYSI_ECOBW Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|C6UCN7|CYSI_ECOBR Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain B / REL606) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|C5W865|CYSI_ECOBD Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain B / BL21-DE3) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|A1JJS3|CYSI_YERE8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|C3LRB7|CYSI_VIBCM Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|Q9KUX3|CYSI_VIBCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|A8ANX0|CYSI_CITK8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A4WDW0|CYSI_ENT38 Sulfite reductase [NADPH] hemoprotein beta-component OS=Enterobacter sp. (strain 638) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|B7UHH5|CYSI_ECO27 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|A7MJ64|CYSI_CROS8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B1JK04|CYSI_YERPY Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|A7FLY9|CYSI_YERP3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|C6CAW9|CYSI_DICDC Sulfite reductase [NADPH] hemoprotein beta-component OS=Dickeya dadantii (strain Ech703) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|C6DDH3|CYSI2_PECCP Sulfite reductase [NADPH] hemoprotein beta-component 2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysI2 PE=3 SV=1 894 1448 0.0E+00
sp|B5EQW2|CYSI_ACIF5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|B7JAM6|CYSI_ACIF2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|A4TPY6|CYSI_YERPP Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis (strain Pestoides F) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|Q1CLS7|CYSI_YERPN Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|Q8ZBN7|CYSI_YERPE Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|Q1C3Z1|CYSI_YERPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|Q6LM59|CYSI_PHOPR Sulfite reductase [NADPH] hemoprotein beta-component OS=Photobacterium profundum GN=cysI PE=3 SV=1 893 1439 0.0E+00
sp|Q66ED3|CYSI_YERPS Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|B2K566|CYSI_YERPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysI PE=3 SV=1 883 1448 0.0E+00
sp|B6ELM5|CYSI_ALISL Sulfite reductase [NADPH] hemoprotein beta-component OS=Aliivibrio salmonicida (strain LFI1238) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|Q6D1A2|CYSI_PECAS Sulfite reductase [NADPH] hemoprotein beta-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysI PE=3 SV=1 894 1448 0.0E+00
sp|B7VI85|CYSI_VIBTL Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio tasmaniensis (strain LGP32) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|Q9PD81|CYSI_XYLFA Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain 9a5c) GN=cysI PE=3 SV=2 894 1438 0.0E+00
sp|Q5E840|CYSI_VIBF1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|B5BEZ8|CYSI_SALPK Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi A (strain AKU_12601) GN=cysI PE=3 SV=1 883 1439 0.0E+00
sp|Q5PEH8|CYSI_SALPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysI PE=3 SV=3 883 1439 0.0E+00
sp|A7MSZ7|CYSI_VIBCB Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|A8G9X7|CYSI_SERP5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Serratia proteamaculans (strain 568) GN=cysI PE=3 SV=1 894 1442 0.0E+00
sp|B5FGI9|CYSI_VIBFM Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio fischeri (strain MJ11) GN=cysI PE=3 SV=1 893 1437 0.0E+00
sp|B2VG06|CYSI_ERWT9 Sulfite reductase [NADPH] hemoprotein beta-component OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysI PE=3 SV=1 887 1439 0.0E+00
sp|A1S9I4|CYSI_SHEAM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysI PE=3 SV=1 893 1438 0.0E+00
sp|C6CLS0|CYSI_DICZE Sulfite reductase [NADPH] hemoprotein beta-component OS=Dickeya zeae (strain Ech1591) GN=cysI PE=3 SV=1 894 1439 0.0E+00
sp|P52673|CYSI_THIRO Sulfite reductase [NADPH] hemoprotein beta-component OS=Thiocapsa roseopersicina GN=cysI PE=3 SV=1 893 1441 0.0E+00
sp|C4L9J8|CYSI_TOLAT Sulfite reductase [NADPH] hemoprotein beta-component OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysI PE=3 SV=1 893 1442 1.0E-180
sp|Q7N8L5|CYSI_PHOLL Sulfite reductase [NADPH] hemoprotein beta-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysI PE=3 SV=1 893 1448 9.0E-180
sp|B4F234|CYSI_PROMH Sulfite reductase [NADPH] hemoprotein beta-component OS=Proteus mirabilis (strain HI4320) GN=cysI PE=3 SV=1 893 1439 2.0E-179
sp|Q5NRM2|CYSI_ZYMMO Sulfite reductase [NADPH] hemoprotein beta-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysI PE=3 SV=1 894 1442 7.0E-179
sp|Q15NK1|CYSI_PSEA6 Sulfite reductase [NADPH] hemoprotein beta-component OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysI PE=3 SV=1 893 1438 9.0E-178
sp|A1T054|CYSI_PSYIN Sulfite reductase [NADPH] hemoprotein beta-component OS=Psychromonas ingrahamii (strain 37) GN=cysI PE=3 SV=1 893 1430 3.0E-177
sp|Q1LTP2|CYSI_BAUCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysI PE=3 SV=1 893 1439 6.0E-177
sp|Q2NVN3|CYSI_SODGM Sulfite reductase [NADPH] hemoprotein beta-component OS=Sodalis glossinidius (strain morsitans) GN=cysI PE=3 SV=1 893 1448 1.0E-175
sp|Q3IFM1|CYSI_PSEHT Sulfite reductase [NADPH] hemoprotein beta-component OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysI PE=3 SV=1 893 1438 2.0E-175
sp|Q7VQH1|CYSI_BLOFL Sulfite reductase [NADPH] hemoprotein beta-component OS=Blochmannia floridanus GN=cysI PE=3 SV=1 893 1437 8.0E-175
sp|B5Y1B5|CYSI2_KLEP3 Sulfite reductase [NADPH] hemoprotein beta-component 2 OS=Klebsiella pneumoniae (strain 342) GN=cysI2 PE=3 SV=1 893 1440 2.0E-174
sp|Q493N3|CYSI_BLOPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysI PE=3 SV=1 893 1437 3.0E-172
sp|C6DCZ7|CYSI1_PECCP Sulfite reductase [NADPH] hemoprotein beta-component 1 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysI1 PE=3 SV=1 893 1440 5.0E-172
sp|B0SNL6|CYSI_LEPBP Sulfite reductase [NADPH] hemoprotein beta-component OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=cysI PE=3 SV=1 894 1437 7.0E-170
sp|B0SF75|CYSI_LEPBA Sulfite reductase [NADPH] hemoprotein beta-component OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=cysI PE=3 SV=1 894 1437 7.0E-170
sp|A6VPZ1|CYSI_ACTSZ Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysI PE=3 SV=1 893 1439 1.0E-169
sp|Q9JUD9|CYSI_NEIMA Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysI PE=3 SV=1 893 1440 2.0E-169
sp|A1KU05|CYSI_NEIMF Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysI PE=3 SV=1 893 1442 3.0E-169
sp|A9LZ72|CYSI_NEIM0 Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysI PE=3 SV=1 893 1440 5.0E-169
sp|Q9JS33|CYSI_NEIMB Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysI1 PE=3 SV=1 893 1440 1.0E-168
sp|B3GZ95|CYSI_ACTP7 Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysI PE=3 SV=1 885 1439 3.0E-167
sp|B0BT17|CYSI_ACTPJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysI PE=3 SV=1 885 1441 3.0E-166
sp|Q8VSR0|CYSI_ACTPL Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae GN=cysI PE=3 SV=1 885 1441 4.0E-166
sp|A3N3D8|CYSI_ACTP2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysI PE=3 SV=1 885 1441 9.0E-166
sp|Q65T54|CYSI_MANSM Sulfite reductase [NADPH] hemoprotein beta-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysI PE=3 SV=1 885 1441 5.0E-165
sp|B8D7V7|CYSI_BUCAT Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysI PE=3 SV=1 894 1437 1.0E-162
sp|P57502|CYSI_BUCAI Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysI PE=3 SV=1 894 1437 2.0E-162
sp|B8D9K5|CYSI_BUCA5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysI PE=3 SV=1 894 1437 2.0E-162
sp|P0C0B2|CYSI_BUCAP Putative sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysI PE=5 SV=1 894 1437 5.0E-160
sp|P30008|SIR_SYNE7 Sulfite reductase [ferredoxin] OS=Synechococcus elongatus (strain PCC 7942) GN=sir PE=3 SV=2 886 1438 9.0E-125
sp|P72854|SIR_SYNY3 Sulfite reductase [ferredoxin] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sir PE=1 SV=1 884 1438 5.0E-124
sp|O82802|SIR1_TOBAC Sulfite reductase 1 [ferredoxin], chloroplastic OS=Nicotiana tabacum GN=SIR1 PE=1 SV=1 887 1436 6.0E-115
sp|Q75NZ0|SIR_PEA Sulfite reductase [ferredoxin], chloroplastic OS=Pisum sativum GN=SIR PE=1 SV=2 872 1436 1.0E-113
sp|O23813|SIR_MAIZE Sulfite reductase [ferredoxin], chloroplastic OS=Zea mays GN=SIR PE=1 SV=1 894 1436 3.0E-111
sp|Q9LZ66|SIR_ARATH Assimilatory sulfite reductase (ferredoxin), chloroplastic OS=Arabidopsis thaliana GN=SIR PE=1 SV=1 884 1436 7.0E-108
sp|Q9AWB2|SIR_SOYBN Sulfite reductase [ferredoxin], chloroplastic (Fragment) OS=Glycine max GN=SIR PE=1 SV=1 894 1386 2.0E-105
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 395 882 3.0E-74
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 395 920 1.0E-53
sp|P03833|NIFJ_KLEPN Pyruvate-flavodoxin oxidoreductase OS=Klebsiella pneumoniae GN=nifJ PE=3 SV=2 395 698 1.0E-36
sp|P19543|NIFJ_ENTAG Pyruvate-flavodoxin oxidoreductase OS=Enterobacter agglomerans GN=nifJ PE=3 SV=3 395 699 3.0E-36
sp|Q3M8N0|NIFJ_ANAVT Pyruvate-flavodoxin oxidoreductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifJ PE=3 SV=1 395 690 1.0E-32
sp|P52965|NIFJ_SYNY3 Putative pyruvate-flavodoxin oxidoreductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nifJ PE=3 SV=1 395 690 3.0E-32
sp|Q06879|NIFJ_NOSS1 Pyruvate-flavodoxin oxidoreductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifJ PE=2 SV=2 395 690 4.0E-32
sp|P94692|POR_DESAF Pyruvate synthase OS=Desulfovibrio africanus GN=por PE=1 SV=1 395 716 1.0E-31
sp|P9WJ03|SIR_MYCTU Sulfite reductase [ferredoxin] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sir PE=1 SV=1 952 1434 7.0E-27
sp|P9WJ02|SIR_MYCTO Sulfite reductase [ferredoxin] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sir PE=3 SV=1 952 1434 7.0E-27
sp|Q7TYP6|SIR_MYCBO Sulfite reductase [ferredoxin] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sir PE=3 SV=2 952 1434 7.0E-27
sp|Q73XV0|SIR2_MYCPA Sulfite reductase [ferredoxin] 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=sir2 PE=3 SV=1 928 1434 2.0E-25
sp|Q73YC1|SIR1_MYCPA Sulfite reductase [ferredoxin] 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=sir1 PE=3 SV=1 928 1434 3.0E-25
sp|P52647|NIFJ_ECOLI Probable pyruvate-flavodoxin oxidoreductase OS=Escherichia coli (strain K12) GN=ydbK PE=3 SV=2 395 689 8.0E-24
sp|Q53046|NIFJ_RHORT Pyruvate-flavodoxin oxidoreductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nifJ PE=3 SV=2 517 698 1.0E-23
sp|Q42997|NIR_ORYSJ Ferredoxin--nitrite reductase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0357100 PE=2 SV=1 955 1374 2.0E-23
sp|Q51879|NIR_PHOLA Ferredoxin--nitrite reductase OS=Phormidium laminosum GN=nirA PE=3 SV=1 955 1418 4.0E-23
sp|P39661|NIR_SYNE7 Ferredoxin--nitrite reductase OS=Synechococcus elongatus (strain PCC 7942) GN=nirA PE=3 SV=1 955 1374 3.0E-21
sp|P17847|NIR_MAIZE Ferredoxin--nitrite reductase, chloroplastic (Fragment) OS=Zea mays GN=NIR PE=2 SV=1 955 1414 5.0E-20
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 721 925 2.0E-19
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 721 876 6.0E-18
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 721 877 1.0E-17
sp|P05314|NIR_SPIOL Ferredoxin--nitrite reductase, chloroplastic OS=Spinacia oleracea GN=NIR PE=1 SV=1 894 1418 3.0E-17
sp|P38500|NIR_BETPN Ferredoxin--nitrite reductase, chloroplastic OS=Betula pendula GN=NIR1 PE=2 SV=1 955 1418 6.0E-17
sp|I3R637|NASD_HALMT Assimilatory ferredoxin-dependent nitrite reductase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=nasD PE=1 SV=1 928 1374 1.0E-16
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 721 874 1.0E-16
sp|Q2UHA7|NCPR_ASPOR NADPH--cytochrome P450 reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cprA PE=3 SV=1 721 893 2.0E-16
sp|Q39161|NIR_ARATH Ferredoxin--nitrite reductase, chloroplastic OS=Arabidopsis thaliana GN=NIR1 PE=1 SV=1 955 1418 6.0E-16
sp|Q6BR77|NDOR1_DEBHA NADPH-dependent diflavin oxidoreductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TAH18 PE=3 SV=2 723 876 8.0E-16
sp|A2QS05|NCPR_ASPNC NADPH--cytochrome P450 reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cprA PE=3 SV=1 721 891 2.0E-15
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 721 903 2.0E-15
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 721 873 3.0E-15
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 721 891 4.0E-15
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 716 878 5.0E-15
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 721 902 5.0E-15
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 721 891 6.0E-15
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 716 878 6.0E-15
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 721 902 6.0E-15
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 721 891 1.0E-14
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 721 891 2.0E-14
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 721 876 3.0E-14
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 721 876 1.0E-13
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 721 876 1.0E-13
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 721 876 3.0E-13
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 722 868 5.0E-13
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 722 868 5.0E-13
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 721 876 1.0E-12
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 713 847 1.0E-12
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 721 900 1.0E-12
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 721 876 2.0E-12
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 723 876 2.0E-12
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 703 873 7.0E-12
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 722 868 8.0E-12
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 721 876 1.0E-11
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 721 876 2.0E-11
sp|P37116|NCPR_VIGRR NADPH--cytochrome P450 reductase OS=Vigna radiata var. radiata PE=1 SV=1 723 876 4.0E-11
sp|Q6CCH0|NDOR1_YARLI NADPH-dependent diflavin oxidoreductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAH18 PE=3 SV=1 715 876 5.0E-11
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 722 890 5.0E-11
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 722 890 5.0E-11
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 723 868 6.0E-11
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 723 869 1.0E-10
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 717 847 1.0E-10
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 721 868 2.0E-10
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 719 859 2.0E-10
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 719 847 2.0E-10
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 719 859 2.0E-10
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 719 847 3.0E-10
sp|P52674|CYSJ_THIRO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Thiocapsa roseopersicina GN=cysJ PE=3 SV=1 721 850 3.0E-10
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 719 859 3.0E-10
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 721 876 4.0E-10
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 721 876 5.0E-10
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 673 877 6.0E-10
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 722 950 7.0E-10
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 718 850 7.0E-10
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 723 847 9.0E-10
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 723 847 1.0E-09
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 723 868 1.0E-09
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 696 873 1.0E-09
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 723 847 2.0E-09
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 717 847 2.0E-09
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 717 847 2.0E-09
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 721 847 2.0E-09
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 723 847 2.0E-09
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 717 847 2.0E-09
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 717 859 2.0E-09
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 723 868 2.0E-09
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 717 859 2.0E-09
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 717 847 2.0E-09
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 717 859 2.0E-09
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 717 859 2.0E-09
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 717 847 2.0E-09
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 717 847 2.0E-09
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 717 847 2.0E-09
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 721 876 2.0E-09
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 721 847 3.0E-09
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 721 876 3.0E-09
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 721 847 4.0E-09
sp|Q17574|MTRR_CAEEL Putative methionine synthase reductase OS=Caenorhabditis elegans GN=tag-165 PE=3 SV=1 721 856 4.0E-09
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 719 868 4.0E-09
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 723 876 5.0E-09
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 723 861 6.0E-09
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 698 847 6.0E-09
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 721 859 6.0E-09
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 717 859 6.0E-09
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 717 859 6.0E-09
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 721 876 7.0E-09
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 714 847 8.0E-09
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 721 847 8.0E-09
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 718 902 1.0E-08
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 717 859 1.0E-08
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 720 876 2.0E-08
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 723 859 2.0E-08
sp|Q4P3D8|NDOR1_USTMA NADPH-dependent diflavin oxidoreductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TAH18 PE=3 SV=2 721 876 2.0E-08
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 721 847 3.0E-08
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 721 884 4.0E-08
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 723 902 5.0E-08
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 718 843 5.0E-08
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 718 843 5.0E-08
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Catharanthus roseus GN=CPR PE=2 SV=1 761 876 5.0E-08
sp|A8G9X6|CYSJ_SERP5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Serratia proteamaculans (strain 568) GN=cysJ PE=3 SV=1 723 847 6.0E-08
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 721 854 9.0E-08
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 721 847 9.0E-08
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 720 898 1.0E-07
sp|P94692|POR_DESAF Pyruvate synthase OS=Desulfovibrio africanus GN=por PE=1 SV=1 76 351 2.0E-07
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 721 847 2.0E-07
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 723 878 2.0E-07
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 721 847 2.0E-07
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 721 847 3.0E-07
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis (strain Pestoides F) GN=cysJ PE=3 SV=1 723 847 4.0E-07
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysJ PE=3 SV=1 723 847 4.0E-07
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis GN=cysJ PE=3 SV=1 723 847 4.0E-07
sp|Q1C3Z0|CYSJ_YERPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysJ PE=3 SV=1 723 847 4.0E-07
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysJ PE=3 SV=1 723 847 4.0E-07
sp|A7FLZ0|CYSJ_YERP3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysJ PE=3 SV=1 723 847 7.0E-07
sp|Q9APC2|NIFJ_NOSSO Pyruvate-flavodoxin oxidoreductase (Fragment) OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=nifJ PE=3 SV=1 69 365 2.0E-06
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 721 847 3.0E-06
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 717 850 6.0E-06
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 718 850 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0020037 heme binding Yes
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0051540 metal cluster binding No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094740
MLTFMAVGQALAAVARIAYLTSDVVVDSHPPFPATSSFNPQFSSLIASCSSSPRLIPAPFGADPGTIILRNSDNL
TSFTATSNAQVLTRLVLHLAELSSKPVVFNIAVQDDLSDVLLLRSSVPYFLLSSTAQQAHDNALLAARLARVERK
AVVYAFYSSHEDGPLDVLSEADITSFLLAPRHSPSTTSSSSGHVTPPGANGSSDEGSENNQTAIGRNGHANGVSV
IDDLTVAALFKAYQVVAAETLSHTRRPLRGLVARGSPEPQTVIIVVGKQDISVPVEGVSFLHLGILSPIPPSQLL
SVIPASVQRVIVLEQVYKWSTKWTPLYLEVVSALQHRSAEQRPTVLSGVLGDLGGVALPDILKLIESTSSSSPLQ
LGTLPSASQKDLILTTPKHESSYTKALHHVFGDQLQVSNAPVLVPTQGQAATTPEFALGRVRGEIDARSDLVATV
EDLLRSDGISSDLHNLLSKWLISKDDGGKSKVLAKDIVASLESSTIDHPAAAKILSLKSHLPAVSRWIIGSDAWS
YDLGASGLHHAIASGLKVNILIIDTLPFTSRNTADPHRRKQDVGLYAMNHGDVYVASVAVFSSYAQVLQAFVEAD
RFNGPSVILAYLPHTSEDAPALQVLKESKLAVDAGYWPLYRWDPSKEREGKEPFSLDSDAIKNDLKQFLDRQNHL
SQLVRPTPQIAAELVSNLGDSIREARKERAQKSYNDLLTSIDAPPLLILYASDSGIAEKKAKRLAGRAKARGLSV
TIAILDSVPLESLAEEEYVAFITSTAGQGEPPQNGRTFFKTLNAAALKGEKIFNTLKFTVFGMGDTHYWPRPEDA
HYYNKPSKDLDARLEKLGGERIASLGLGDDQDADGPETGYKVWEPLLWKALGVDSVEVTEAEPEPITNEHIKAAS
LYLRGTISEGLNDFTTGALAASDTQLTKFHGIYQQDDRDIRDERQAQNVEPAYSFMIRVRLPGGVCTPEQWLQVD
QIADEHGTGTFKITTRQTFQFHGVIKRHLKPAIQDINRVLLDTLAACGDVNRNVVCSSIPSFSKLHAQVYDFAKS
VSNHLIPRTTAYHEIWLDKKLVAGEALKDFEPYYGEFYLPRKYKIAVAVPPTNDVDVFANDVGFIAIVNKKGELE
GFNVAIGGGMGVTHGNKKTYPRLASIIGFCTIEQGKFVAEKIMLVQRDNGNRVDRKNARLKYTIDRMGLDVYKAE
VEKLLGYTLQPPRPFTFDRNIDDFGWHVGQDGRHHFMMFIENGRIQNEPGRDFKTGLREIAKVHKGAFRLTTNQH
LMISDIPSEELETIKNILAKYKMDNLNYSGLRLSSSACVAFPTCGLAMAESERYLPLLIDKVEKMCEENGLRNDA
IVMRMTGCPNGCARPYVAEVAFIGKAPGTYSMLLGGGYHGQRLNKIYRESVTEPEILAILEPMIKHYAKSRLPEE
HFGDFTLRAGYIAPTTEGKAWYDRSGGEGVYRETTAIAAV*
Coding >AgabiH97|094740
ATGCTGACCTTCATGGCTGTCGGTCAAGCCTTGGCCGCCGTTGCACGCATTGCATACTTGACTTCAGATGTCGTA
GTCGATTCCCATCCTCCTTTCCCTGCAACTTCGTCATTTAATCCCCAATTCTCTTCTCTTATCGCATCATGCTCT
AGCTCACCTCGTCTTATACCGGCTCCCTTCGGTGCAGATCCCGGTACCATAATTCTTCGTAACTCTGACAATCTC
ACGAGTTTTACGGCGACGTCTAATGCTCAGGTTCTCACCCGCCTCGTCCTCCACCTCGCTGAACTTTCCTCCAAA
CCCGTCGTCTTCAACATTGCTGTTCAAGATGATTTGTCTGATGTGCTCCTCCTTCGTTCATCGGTGCCCTACTTC
TTGTTATCTTCAACCGCTCAACAAGCGCATGACAATGCTCTGTTGGCCGCACGGCTGGCACGGGTGGAACGAAAA
GCAGTCGTTTATGCTTTCTACAGTTCTCACGAAGACGGGCCGTTGGATGTGCTCTCAGAAGCCGATATTACCTCC
TTCCTCCTTGCTCCTAGGCATTCCCCGTCTACGACTTCTTCATCTAGTGGGCATGTGACACCACCGGGTGCTAAC
GGATCTAGTGATGAAGGCAGCGAAAATAACCAAACGGCGATTGGGCGAAACGGTCATGCAAATGGTGTAAGCGTC
ATTGACGATCTAACTGTGGCTGCTCTCTTCAAGGCTTATCAAGTTGTGGCTGCCGAGACGCTTAGTCATACAAGA
CGTCCTTTGCGTGGTTTGGTTGCCCGAGGCTCTCCAGAACCGCAAACGGTGATAATCGTCGTCGGAAAACAGGAC
ATTTCTGTCCCAGTTGAAGGCGTCTCCTTCCTACATCTGGGCATACTCAGCCCAATTCCTCCATCTCAGCTGCTG
AGTGTCATCCCCGCATCTGTTCAGCGTGTTATCGTGCTCGAACAGGTCTATAAATGGTCGACGAAATGGACACCT
TTATACCTCGAAGTTGTGAGCGCTCTCCAACACCGTAGTGCAGAACAGCGTCCTACTGTTCTGAGTGGTGTCCTT
GGTGACCTTGGTGGTGTTGCTCTTCCAGACATCCTCAAGCTAATCGAATCCACATCCTCCTCTTCTCCGCTTCAG
TTGGGAACATTGCCCTCCGCTTCACAGAAAGACCTCATACTCACCACGCCCAAGCACGAATCTTCTTACACCAAG
GCCCTTCATCATGTCTTTGGGGATCAGCTACAGGTTTCAAACGCGCCTGTTCTTGTTCCTACGCAGGGACAGGCG
GCGACAACTCCTGAGTTCGCCCTTGGGCGTGTCCGTGGTGAGATCGACGCGCGATCTGATCTTGTGGCCACGGTC
GAAGACCTGCTGCGCAGTGACGGCATCAGTTCCGACCTTCATAACTTGCTAAGCAAATGGCTTATTTCCAAGGAT
GATGGTGGCAAGAGTAAGGTGCTCGCGAAGGACATTGTAGCTTCGCTTGAGTCGTCCACCATTGATCACCCTGCC
GCAGCTAAAATTCTTTCCCTCAAATCTCATCTACCGGCCGTTTCGAGATGGATCATAGGTTCCGACGCGTGGTCG
TATGATCTTGGTGCCTCAGGGCTCCATCACGCCATCGCTTCTGGTCTGAAAGTCAATATCCTTATTATCGATACA
TTGCCATTCACCTCTCGTAATACCGCTGATCCCCATCGAAGAAAGCAGGATGTCGGCCTGTACGCTATGAATCAT
GGCGATGTCTATGTTGCCAGTGTTGCTGTCTTCTCTTCGTATGCCCAGGTCTTGCAGGCATTTGTGGAGGCTGAT
AGGTTTAACGGGCCAAGTGTCATTTTGGCATACCTTCCTCATACGTCGGAGGATGCTCCTGCTCTCCAGGTATTG
AAGGAAAGTAAACTTGCAGTTGATGCTGGATATTGGCCACTTTATCGTTGGGATCCCAGCAAGGAGCGTGAAGGG
AAAGAACCATTTTCCTTGGACTCAGACGCTATCAAGAACGACCTTAAACAGTTCCTTGATCGCCAGAACCATCTT
TCACAGCTCGTTCGCCCCACTCCTCAAATTGCCGCCGAGCTTGTTAGCAACTTGGGAGACAGTATTCGTGAAGCA
AGGAAGGAGCGTGCACAGAAGTCTTACAACGACTTACTTACTTCTATTGACGCTCCTCCCCTTCTGATTTTGTAC
GCCTCTGATTCAGGGATCGCTGAAAAGAAGGCCAAACGTCTTGCTGGAAGGGCTAAAGCCCGTGGCCTCTCGGTT
ACCATCGCCATCTTGGATTCCGTTCCTCTCGAAAGTCTCGCGGAAGAGGAATACGTTGCATTCATTACTTCTACT
GCCGGACAGGGAGAACCTCCTCAGAATGGACGTACCTTTTTCAAGACCTTGAATGCGGCTGCTCTCAAGGGTGAA
AAGATCTTCAACACACTCAAGTTCACGGTTTTTGGTATGGGCGATACACACTACTGGCCTCGTCCTGAAGACGCT
CATTATTACAACAAGCCATCAAAGGACTTGGATGCTCGTTTGGAGAAACTTGGTGGAGAGCGCATCGCTAGTCTT
GGACTCGGTGATGATCAGGACGCAGACGGACCTGAGACTGGTTACAAGGTCTGGGAGCCTCTTTTGTGGAAAGCA
CTTGGGGTTGACTCTGTTGAAGTCACCGAAGCGGAGCCCGAGCCCATCACGAACGAGCACATAAAGGCTGCATCC
CTGTATCTGCGCGGAACGATCAGTGAAGGCCTGAATGATTTCACTACTGGTGCCCTTGCTGCTAGTGATACGCAA
TTAACTAAGTTCCATGGAATCTACCAACAAGACGACCGCGATATCCGTGATGAGCGACAAGCACAGAATGTCGAG
CCGGCTTATAGCTTCATGATTCGAGTGCGGTTGCCGGGAGGTGTCTGCACTCCTGAGCAGTGGTTGCAAGTGGAC
CAGATTGCGGATGAGCATGGAACTGGAACGTTCAAGATCACGACGCGTCAAACTTTCCAATTTCATGGTGTCATC
AAGAGGCATTTGAAGCCTGCCATTCAGGATATTAATCGCGTTCTATTGGATACTCTTGCTGCTTGCGGTGATGTC
AACAGAAACGTTGTCTGCTCTTCGATTCCCTCTTTCTCCAAGCTCCATGCTCAGGTGTATGACTTTGCTAAGAGC
GTCAGCAATCATCTTATTCCTCGTACGACTGCCTATCACGAGATTTGGCTCGACAAGAAGCTTGTCGCTGGCGAG
GCCTTGAAGGACTTTGAGCCATATTATGGTGAATTTTACTTACCTCGCAAGTACAAAATCGCAGTGGCGGTTCCA
CCCACTAATGATGTTGATGTCTTCGCAAACGATGTCGGCTTCATTGCCATCGTAAACAAGAAGGGTGAACTTGAG
GGTTTCAATGTCGCTATCGGTGGTGGTATGGGCGTCACTCATGGAAACAAGAAAACTTATCCCCGTCTTGCAAGT
ATTATCGGTTTCTGTACGATTGAGCAGGGTAAATTTGTCGCTGAAAAGATCATGTTGGTCCAGAGGGACAATGGG
AACCGTGTCGACCGTAAGAACGCCCGACTCAAATACACTATCGATCGGATGGGTCTCGACGTCTATAAAGCCGAA
GTTGAGAAACTTCTTGGCTACACTCTTCAACCTCCCCGCCCCTTTACCTTTGATCGCAACATTGACGACTTTGGT
TGGCATGTCGGCCAAGATGGCAGACACCACTTCATGATGTTCATCGAAAATGGCCGCATCCAAAATGAACCCGGG
CGCGATTTCAAGACTGGACTGCGTGAGATTGCTAAAGTGCACAAGGGCGCGTTTAGGTTGACCACGAATCAACAT
TTGATGATTTCGGATATCCCGTCTGAGGAACTGGAAACGATCAAGAATATTTTGGCGAAGTATAAGATGGATAAT
CTTAATTATAGTGGATTGAGGTTGAGTTCTTCGGCTTGTGTGGCGTTCCCGACTTGTGGGCTGGCGATGGCCGAG
TCTGAGCGGTATCTCCCATTGTTGATCGACAAAGTTGAGAAAATGTGTGAAGAGAATGGGTTACGGAATGATGCT
ATTGTCATGCGCATGACTGGTTGTCCGAATGGTTGCGCACGTCCCTACGTCGCAGAGGTCGCTTTCATTGGAAAA
GCACCAGGGACATACTCTATGCTCCTCGGTGGCGGTTACCACGGACAACGTCTGAACAAAATCTATCGTGAATCC
GTCACGGAACCCGAAATTCTCGCCATCCTCGAACCCATGATCAAACATTACGCGAAATCACGCCTTCCTGAAGAA
CATTTTGGTGATTTCACGCTTCGTGCTGGGTATATTGCGCCTACGACTGAGGGGAAAGCGTGGTATGATCGATCG
GGCGGTGAAGGTGTTTATCGTGAAACTACAGCTATTGCTGCTGTGTAA
Transcript >AgabiH97|094740
ATGCTGACCTTCATGGCTGTCGGTCAAGCCTTGGCCGCCGTTGCACGCATTGCATACTTGACTTCAGATGTCGTA
GTCGATTCCCATCCTCCTTTCCCTGCAACTTCGTCATTTAATCCCCAATTCTCTTCTCTTATCGCATCATGCTCT
AGCTCACCTCGTCTTATACCGGCTCCCTTCGGTGCAGATCCCGGTACCATAATTCTTCGTAACTCTGACAATCTC
ACGAGTTTTACGGCGACGTCTAATGCTCAGGTTCTCACCCGCCTCGTCCTCCACCTCGCTGAACTTTCCTCCAAA
CCCGTCGTCTTCAACATTGCTGTTCAAGATGATTTGTCTGATGTGCTCCTCCTTCGTTCATCGGTGCCCTACTTC
TTGTTATCTTCAACCGCTCAACAAGCGCATGACAATGCTCTGTTGGCCGCACGGCTGGCACGGGTGGAACGAAAA
GCAGTCGTTTATGCTTTCTACAGTTCTCACGAAGACGGGCCGTTGGATGTGCTCTCAGAAGCCGATATTACCTCC
TTCCTCCTTGCTCCTAGGCATTCCCCGTCTACGACTTCTTCATCTAGTGGGCATGTGACACCACCGGGTGCTAAC
GGATCTAGTGATGAAGGCAGCGAAAATAACCAAACGGCGATTGGGCGAAACGGTCATGCAAATGGTGTAAGCGTC
ATTGACGATCTAACTGTGGCTGCTCTCTTCAAGGCTTATCAAGTTGTGGCTGCCGAGACGCTTAGTCATACAAGA
CGTCCTTTGCGTGGTTTGGTTGCCCGAGGCTCTCCAGAACCGCAAACGGTGATAATCGTCGTCGGAAAACAGGAC
ATTTCTGTCCCAGTTGAAGGCGTCTCCTTCCTACATCTGGGCATACTCAGCCCAATTCCTCCATCTCAGCTGCTG
AGTGTCATCCCCGCATCTGTTCAGCGTGTTATCGTGCTCGAACAGGTCTATAAATGGTCGACGAAATGGACACCT
TTATACCTCGAAGTTGTGAGCGCTCTCCAACACCGTAGTGCAGAACAGCGTCCTACTGTTCTGAGTGGTGTCCTT
GGTGACCTTGGTGGTGTTGCTCTTCCAGACATCCTCAAGCTAATCGAATCCACATCCTCCTCTTCTCCGCTTCAG
TTGGGAACATTGCCCTCCGCTTCACAGAAAGACCTCATACTCACCACGCCCAAGCACGAATCTTCTTACACCAAG
GCCCTTCATCATGTCTTTGGGGATCAGCTACAGGTTTCAAACGCGCCTGTTCTTGTTCCTACGCAGGGACAGGCG
GCGACAACTCCTGAGTTCGCCCTTGGGCGTGTCCGTGGTGAGATCGACGCGCGATCTGATCTTGTGGCCACGGTC
GAAGACCTGCTGCGCAGTGACGGCATCAGTTCCGACCTTCATAACTTGCTAAGCAAATGGCTTATTTCCAAGGAT
GATGGTGGCAAGAGTAAGGTGCTCGCGAAGGACATTGTAGCTTCGCTTGAGTCGTCCACCATTGATCACCCTGCC
GCAGCTAAAATTCTTTCCCTCAAATCTCATCTACCGGCCGTTTCGAGATGGATCATAGGTTCCGACGCGTGGTCG
TATGATCTTGGTGCCTCAGGGCTCCATCACGCCATCGCTTCTGGTCTGAAAGTCAATATCCTTATTATCGATACA
TTGCCATTCACCTCTCGTAATACCGCTGATCCCCATCGAAGAAAGCAGGATGTCGGCCTGTACGCTATGAATCAT
GGCGATGTCTATGTTGCCAGTGTTGCTGTCTTCTCTTCGTATGCCCAGGTCTTGCAGGCATTTGTGGAGGCTGAT
AGGTTTAACGGGCCAAGTGTCATTTTGGCATACCTTCCTCATACGTCGGAGGATGCTCCTGCTCTCCAGGTATTG
AAGGAAAGTAAACTTGCAGTTGATGCTGGATATTGGCCACTTTATCGTTGGGATCCCAGCAAGGAGCGTGAAGGG
AAAGAACCATTTTCCTTGGACTCAGACGCTATCAAGAACGACCTTAAACAGTTCCTTGATCGCCAGAACCATCTT
TCACAGCTCGTTCGCCCCACTCCTCAAATTGCCGCCGAGCTTGTTAGCAACTTGGGAGACAGTATTCGTGAAGCA
AGGAAGGAGCGTGCACAGAAGTCTTACAACGACTTACTTACTTCTATTGACGCTCCTCCCCTTCTGATTTTGTAC
GCCTCTGATTCAGGGATCGCTGAAAAGAAGGCCAAACGTCTTGCTGGAAGGGCTAAAGCCCGTGGCCTCTCGGTT
ACCATCGCCATCTTGGATTCCGTTCCTCTCGAAAGTCTCGCGGAAGAGGAATACGTTGCATTCATTACTTCTACT
GCCGGACAGGGAGAACCTCCTCAGAATGGACGTACCTTTTTCAAGACCTTGAATGCGGCTGCTCTCAAGGGTGAA
AAGATCTTCAACACACTCAAGTTCACGGTTTTTGGTATGGGCGATACACACTACTGGCCTCGTCCTGAAGACGCT
CATTATTACAACAAGCCATCAAAGGACTTGGATGCTCGTTTGGAGAAACTTGGTGGAGAGCGCATCGCTAGTCTT
GGACTCGGTGATGATCAGGACGCAGACGGACCTGAGACTGGTTACAAGGTCTGGGAGCCTCTTTTGTGGAAAGCA
CTTGGGGTTGACTCTGTTGAAGTCACCGAAGCGGAGCCCGAGCCCATCACGAACGAGCACATAAAGGCTGCATCC
CTGTATCTGCGCGGAACGATCAGTGAAGGCCTGAATGATTTCACTACTGGTGCCCTTGCTGCTAGTGATACGCAA
TTAACTAAGTTCCATGGAATCTACCAACAAGACGACCGCGATATCCGTGATGAGCGACAAGCACAGAATGTCGAG
CCGGCTTATAGCTTCATGATTCGAGTGCGGTTGCCGGGAGGTGTCTGCACTCCTGAGCAGTGGTTGCAAGTGGAC
CAGATTGCGGATGAGCATGGAACTGGAACGTTCAAGATCACGACGCGTCAAACTTTCCAATTTCATGGTGTCATC
AAGAGGCATTTGAAGCCTGCCATTCAGGATATTAATCGCGTTCTATTGGATACTCTTGCTGCTTGCGGTGATGTC
AACAGAAACGTTGTCTGCTCTTCGATTCCCTCTTTCTCCAAGCTCCATGCTCAGGTGTATGACTTTGCTAAGAGC
GTCAGCAATCATCTTATTCCTCGTACGACTGCCTATCACGAGATTTGGCTCGACAAGAAGCTTGTCGCTGGCGAG
GCCTTGAAGGACTTTGAGCCATATTATGGTGAATTTTACTTACCTCGCAAGTACAAAATCGCAGTGGCGGTTCCA
CCCACTAATGATGTTGATGTCTTCGCAAACGATGTCGGCTTCATTGCCATCGTAAACAAGAAGGGTGAACTTGAG
GGTTTCAATGTCGCTATCGGTGGTGGTATGGGCGTCACTCATGGAAACAAGAAAACTTATCCCCGTCTTGCAAGT
ATTATCGGTTTCTGTACGATTGAGCAGGGTAAATTTGTCGCTGAAAAGATCATGTTGGTCCAGAGGGACAATGGG
AACCGTGTCGACCGTAAGAACGCCCGACTCAAATACACTATCGATCGGATGGGTCTCGACGTCTATAAAGCCGAA
GTTGAGAAACTTCTTGGCTACACTCTTCAACCTCCCCGCCCCTTTACCTTTGATCGCAACATTGACGACTTTGGT
TGGCATGTCGGCCAAGATGGCAGACACCACTTCATGATGTTCATCGAAAATGGCCGCATCCAAAATGAACCCGGG
CGCGATTTCAAGACTGGACTGCGTGAGATTGCTAAAGTGCACAAGGGCGCGTTTAGGTTGACCACGAATCAACAT
TTGATGATTTCGGATATCCCGTCTGAGGAACTGGAAACGATCAAGAATATTTTGGCGAAGTATAAGATGGATAAT
CTTAATTATAGTGGATTGAGGTTGAGTTCTTCGGCTTGTGTGGCGTTCCCGACTTGTGGGCTGGCGATGGCCGAG
TCTGAGCGGTATCTCCCATTGTTGATCGACAAAGTTGAGAAAATGTGTGAAGAGAATGGGTTACGGAATGATGCT
ATTGTCATGCGCATGACTGGTTGTCCGAATGGTTGCGCACGTCCCTACGTCGCAGAGGTCGCTTTCATTGGAAAA
GCACCAGGGACATACTCTATGCTCCTCGGTGGCGGTTACCACGGACAACGTCTGAACAAAATCTATCGTGAATCC
GTCACGGAACCCGAAATTCTCGCCATCCTCGAACCCATGATCAAACATTACGCGAAATCACGCCTTCCTGAAGAA
CATTTTGGTGATTTCACGCTTCGTGCTGGGTATATTGCGCCTACGACTGAGGGGAAAGCGTGGTATGATCGATCG
GGCGGTGAAGGTGTTTATCGTGAAACTACAGCTATTGCTGCTGTGTAA
Gene >AgabiH97|094740
ATGGTGTTCTTCACGATCGTCTTTTCCAACCCGTCTTCCTTTCGTTCCACAAGCTGGTATGTACCTTTATAACGT
TGTACTCTTTAAACACAAATATCTGACCCTCCATAGACCTTCATGGCTGTCGGTCAAGCCTTGGCCGCCGTTGCA
CGCATTGCATACTTGACTTCAGATGTCGTAGTCGATTCCCATCCTCCTTTCCCTGCAACTTCGTCATTTAATCCC
CAATTCTCTTCTCTTATCGCATCATGCTCTAGCTCACCTCGTCTTATACCGGCTCCCTTCGGTGCAGATCCCGGT
ACCATAATTCTTCGTAACTCTGACAATCTCACGAGTTTTACGGCGACGTCTAATGCTCAGGTTCTCACCCGCCTC
GTCCTCCACCTCGCTGAACTTTCCTCCAAACCCGTCGTCTTCAACATTGCTGTTCAAGATGATTTGTCTGATGTG
CTCCTCCTTCGTTCATCGGTGCCCTACTTCTTGTTATCTTCAACCGCTCAACAAGCGCATGACAATGCTCTGTTG
GCCGCACGGCTGGCACGGGTGGAACGAAAAGCAGTCGTTTATGCTTTCTACAGTTCTCACGAAGACGGGCCGTTG
GATGTGCTCTCAGAAGCCGATATTACCTCCTTCCTCCTTGCTCCTAGGCATTCCCCGTCTACGACTTCTTCATCT
AGTGGGCATGTGACACCACCGGGTGCTAACGGATCTAGTGATGAAGGCAGCGAAAATAACCAAACGGCGATTGGG
CGAAACGGTCATGCAAATGGTGTAAGCGTCATTGACGATCTAACTGTGGCTGCTCTCTTCAAGGCTTATCAAGTT
GTGGCTGCCGAGACGCTTAGTCATACAAGACGTCCTTTGCGTGGTTTGGTTGCCCGAGGCTCTCCAGAACCGCAA
ACGGTGATAATCGTCGTCGGAAAACAGGACATTTCTGTCCCAGTTGAAGGCGTCTCCTTCCTACATCTGGGCATA
CTCAGCCCAATTCCTCCATCTCAGCTGCTGAGTGTCATCCCCGCATCTGTTCAGCGTGTTATCGTGCTCGAACAG
GTCTATAAATGGTCGACGAAATGGACACCTTTATACCTCGAAGTTGTGAGCGCTCTCCAACACCGTAGTGCAGAA
CAGCGTCCTACTGTTCTGAGTGGTGTCCTTGGTGACCTTGGTGGTGTTGCTCTTCCAGACATCCTCAAGCTAATC
GAATCCACATCCTCCTCTTCTCCGCTTCAGTTGGGAACATTGCCCTCCGCTTCACAGAAAGACCTCATACTCACC
ACGCCCAAGCACGAATCTTCTTACACCAAGGCCCTTCATCATGTCTTTGGGGATCAGCTACAGGTTTCAAACGCG
CCTGTTCTTGTTCCTACGCAGGGACAGGCGGCGACAACTCCTGAGTTCGCCCTTGGGCGTGTCCGTGGTGAGATC
GACGCGCGATCTGATCTTGTGGCCACGGTCGAAGACCTGCTGCGCAGTGACGGCATCAGTTCCGACCTTCATAAC
TTGCTAAGCAAATGGCTTATTTCCAAGGATGATGGTGGCAAGAGTAAGGTGCTCGCGAAGGACATTGTAGCTTCG
CTTGAGTCGTCCACCATTGATCACCCTGCCGCAGCTAAAATTCTTTCCCTCAAATCTCATCTACCGGCCGTTTCG
AGATGGATCATAGGTTCCGACGCGTGGTCGTATGATCTTGGTGCCTCAGGGCTCCATCACGCCATCGCTTCTGGT
CTGAAAGTCAATATCCTTATTATCGATACATTGCCATTCACCTCTCGTAATACCGCTGATCCCCATCGAAGAAAG
CAGGATGTCGGCCTGTACGCTATGAATCATGGCGATGTCTATGTTGCCAGTGTTGCTGTCTTCTCTTCGTATGCC
CAGGTCTTGCAGGCATTTGTGGAGGCTGATAGGTTTAACGGGCCAAGTGTCATTTTGGCATACCTTCCTCATACG
TCGGAGGATGCTCCTGCTCTCCAGGTATTGAAGGAAAGTAAACTTGCAGTTGATGCTGGATATTGGCCACTTTAT
CGTTGGGATCCCAGCAAGGAGCGTGAAGGGAAAGAACCATTTTCCTTGGACTCAGACGCTATCAAGAACGACCTT
AAACAGTTCCTTGATCGCCAGAACCATCTTTCACAGCTCGTTCGCCCCACTCCTCAAATTGCCGCCGAGCTTGTT
AGCAACTTGGGAGACAGTATTCGTGAAGCAAGGAAGGAGCGTGCACAGAAGTCTTACAACGACTTACTTACTTCT
ATTGACGCTCCTCCCCTTCTGATTTTGTACGCCTCTGATTCAGGGATCGCTGAAAAGAAGGCCAAACGTCTTGCT
GGAAGGGCTAAAGCCCGTGGCCTCTCGGTTACCATCGCCATCTTGGATTCCGTTCCTCTCGAAAGTCTCGCGGAA
GAGGAATACGTTGCATTCATTACTTCTACTGCCGGACAGGGAGAACCTCCTCAGAATGGACGTACCTTTTTCAAG
ACCTTGAATGCGGCTGCTCTCAAGGGTGAAAAGATCTTCAACACACTCAAGTTCACGGTTTTTGGTATGGGCGAT
ACACACTACTGGCCTCGTCCTGAAGACGCTCATTATTACAACAAGCCATCAAAGGACTTGGATGCTCGTTTGGAG
AAACTTGGTGGAGAGCGCATCGCTAGTCTTGGACTCGGTGATGATCAGGACGCAGACGGACCTGAGACTGGTTAC
AAGGTCTGGGAGCCTCTTTTGTGGAAAGCACTTGGGGTTGACTCTGTTGAAGTCACCGAAGCGGAGCCCGAGCCC
ATCACGAACGAGCACATAAAGGCTGCATCCCTGTATCTGCGCGGAACGATCAGTGAAGGCCTGAATGATTTCACT
ACTGGTGCCCTTGCTGCTAGTGATACGCAATTAACTAAGTTCCATGGAATCTACCAACAAGACGACCGCGATATC
CGTGATGAGCGACAAGCACAGAATGTCGAGCCGGCTTATAGCTTCATGATTCGAGTGCGGTTGCCGGGAGGTGTC
TGCACTCCTGAGCAGTGGTTGCAAGTGGACCAGATTGCGGATGAGCATGGAACTGGAACGTTCAAGATCACGACG
CGTCAAACTTTCCAATTTCATGGTGTCATCAAGAGGCATTTGAAGCCTGCCATTCAGGATATTAATCGCGTTCTA
TTGGATACTCTTGCTGCTTGCGGTGATGTCAACAGGTGAGCCGTTACAAAAAATCCTACTTTTGAAATAGCTAAC
GAGGTTTAGAAACGTTGTCTGCTCTTCGATTCCCTCTTTCTCCAAGCTCCATGCTCAGGTGTATGACTTTGCTAA
GAGCGTCAGCAATCATCTTATTCCTCGTACGACTGCCTATCACGAGATTTGGCTCGACAAGAAGCTTGTCGCTGG
CGAGGCCTTGAAGGACTTTGAGCCATATTATGGTGAATTTTACTTACCTCGCAAGGTGCGCTTAGTATGCGTCAA
AAAGAAAAGAACCAACTGATTGAATATCTGCATTTTTTAGTACAAAATCGCAGTGGCGGTTCCACCCACTAATGA
TGTTGATGTCTTCGCAAACGATGTCGGCTTCATTGCCATCGTAAACAAGAAGGGTGAACTTGAGGGTTTCAATGT
CGCTATCGGTGGTGGTATGGGCGTCACTCATGGAAACAAGAAAACTTATCCCCGTCTTGCAAGTATTATCGGTTT
CTGTACGATTGAGCAGGGTAAATTTGTCGCTGAAAAGATCATGTTGGTCCAGAGGGACAATGGGAACCGTGTCGA
GTAAGTCGCTATAAACCACTATTTTCACCCATTAATAGAATCTTCCAGCCGTAAGAACGCCCGACTCAAATACAC
TATCGATCGGATGGGTCTCGACGTCTATAAAGCCGAAGTTGAGAAACTTCTTGGCTACACTCTTCAACCTCCCCG
CCCCTTTACCTTTGATCGCAACATTGACGACTTTGGTTGGCATGTCGGCCAAGATGGCAGACACCACTTCATGAT
GTTCATCGAAAATGGCCGCATCCAAAATGAACCCGGGCGCGATTTCAAGACTGGACTGCGTGAGATTGCTAAAGT
GCACAAGGGCGCGTTTAGGTTGACCACGAATCAACATTTGATGATTTCGGATATCCCGTCTGAGGAACTGGAAAC
GATCAAGAATATTTTGGCGAAGTATAAGATGGATAATCTTAATTATAGTGGATTGAGGTTGAGTTCTTCGGCTTG
TGTGGCGTTCCCGACTTGTGGGCTGGCGATGGCCGAGTCTGAGCGGGTGAGTGGTCTGTTACTTTTGGCTTATAC
ATTTCGATGACAGAGGTAAATGAATAGTATCTCCCATTGTTGATCGACAAAGTTGAGAAAATGTGTGAAGAGAAT
GGGTTACGGAATGATGCTATTGTCATGCGCATGACTGGTTGTCCGAATGGTTGCGCACGTCCCTACGTCGCAGGT
ATGTATTTCAAGACTTATTTTCTGGGTTTCGGTGTTTCTGATAACAATTACAGAGGTCGCTTTCATTGGAAAAGC
ACCAGGGACATACTCTATGCTCCTCGGTGGCGGTTACCACGGACAACGTCTGAACAAAATCTATCGTGGTACGTC
TTCTCCACCTTCCCCACATTTCCCACTCCTCCAGCCCCACTGACTTTTTCCCTACCTACCAAAAAGAATCCGTCA
CGGAACCCGAAATTCTCGCCATCCTCGAACCCATGATCAAACATTACGCGAAATCACGCCTTCCTGAAGAACATT
TTGGTGATTTCACGCTTCGTGCTGGGTATATTGCGCCTACGACTGAGGGGAAAGCGTGGTATGATCGATCGGGCG
GTGAAGGTGTTTATCGTGAAACTACAGCTATTGCTGCTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail