Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094650
Gene name
Locationscaffold_6:1632415..1636884
Strand-
Gene length (bp)4469
Transcript length (bp)3252
Coding sequence length (bp)3252
Protein length (aa) 1084

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 3.3E-146 517 949
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 5.2E-80 114 453
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 3.8E-18 986 1061

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 6 1083 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 26 1083 0.0E+00
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 72 1079 0.0E+00
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 63 1083 0.0E+00
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 66 1078 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 6 1083 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 26 1083 0.0E+00
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 72 1079 0.0E+00
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 63 1083 0.0E+00
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 66 1078 0.0E+00
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 58 1083 0.0E+00
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 73 1083 0.0E+00
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 58 1083 0.0E+00
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 56 1083 0.0E+00
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 73 1083 0.0E+00
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 38 1078 0.0E+00
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 74 1083 0.0E+00
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 72 993 0.0E+00
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 74 1083 0.0E+00
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 108 1067 0.0E+00
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 102 952 2.0E-128
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 102 1002 4.0E-122
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 116 938 2.0E-116
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 116 938 2.0E-116
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 116 938 2.0E-116
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 219 935 2.0E-109
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 39 935 5.0E-108
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 108 935 1.0E-107
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 108 950 1.0E-106
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 108 950 3.0E-106
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 108 935 3.0E-106
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 108 950 2.0E-100
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 108 950 1.0E-99
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 108 950 2.0E-98
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 108 955 9.0E-92
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 216 956 2.0E-88
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 286 1067 5.0E-86
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 279 1071 1.0E-85
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 279 1071 2.0E-85
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 108 950 1.0E-83
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 316 1077 3.0E-80
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 219 938 8.0E-80
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 286 1069 1.0E-79
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 219 938 2.0E-79
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 219 938 2.0E-76
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 219 938 2.0E-76
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 219 903 4.0E-76
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 219 903 8.0E-76
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 219 903 9.0E-76
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 219 903 1.0E-75
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 219 903 2.0E-74
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 219 903 1.0E-73
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 285 947 4.0E-73
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 108 951 3.0E-72
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 459 987 3.0E-68
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 283 936 1.0E-61
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 284 946 1.0E-60
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 85 947 5.0E-57
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 113 947 6.0E-57
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 113 947 6.0E-57
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 553 909 4.0E-56
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 553 909 5.0E-56
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 103 947 2.0E-55
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 284 979 1.0E-53
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 284 947 2.0E-53
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 284 946 2.0E-53
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 229 965 4.0E-53
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 286 946 1.0E-52
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 548 950 2.0E-52
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 361 951 2.0E-50
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 220 947 4.0E-50
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 361 951 8.0E-50
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 361 951 2.0E-49
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 219 951 5.0E-49
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 341 1041 5.0E-49
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 344 1055 3.0E-48
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 347 951 5.0E-48
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 193 951 3.0E-47
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 218 949 7.0E-47
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 219 957 8.0E-45
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 337 949 1.0E-44
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 340 957 3.0E-44
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 228 972 1.0E-43
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 625 950 2.0E-43
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 625 950 2.0E-43
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 214 600 9.0E-43
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 214 600 1.0E-42
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 229 949 4.0E-40
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 431 771 8.0E-39
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 451 716 2.0E-38
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 103 601 6.0E-36
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 220 742 2.0E-35
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 284 679 3.0E-33
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 365 960 8.0E-30
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 695 950 1.0E-29
sp|O05706|DPOL3_SULSH DNA polymerase 3 OS=Sulfolobus shibatae GN=dpo3 PE=3 SV=1 108 957 1.0E-28
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 286 679 2.0E-28
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 108 716 1.0E-27
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 462 608 3.0E-27
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 631 949 5.0E-27
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 284 679 1.0E-26
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 160 679 4.0E-26
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 625 863 1.0E-25
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 631 862 1.0E-25
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 632 878 3.0E-25
sp|P42489|DPOL_ASFB7 DNA polymerase beta OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=DPOL PE=3 SV=1 89 936 9.0E-25
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 91 465 1.0E-24
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 728 953 9.0E-24
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 228 545 1.0E-23
sp|P0C972|DPOL_ASFM2 DNA polymerase beta OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-098 PE=3 SV=1 89 936 1.0E-23
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 300 459 3.0E-23
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 108 554 6.0E-23
sp|P0C974|DPOL_ASFK5 DNA polymerase beta OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-102 PE=3 SV=1 89 936 6.0E-23
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 108 554 7.0E-23
sp|P0C973|DPOL_ASFWA DNA polymerase beta OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-100 PE=3 SV=1 89 936 8.0E-23
sp|P0C971|DPOL_ASFP4 DNA polymerase beta OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=DPOL PE=3 SV=1 89 936 9.0E-23
sp|P43139|DPOL_ASFL6 DNA polymerase beta OS=African swine fever virus (isolate Pig/Portugal/Lis 60/1960) GN=DPOL PE=3 SV=1 288 936 4.0E-22
sp|Q6WI70|DPOL_BPKVM DNA polymerase OS=Vibrio phage KVP40 (isolate Vibrio parahaemolyticus/Japan/Matsuzaki/1991) GN=43 PE=3 SV=1 283 840 8.0E-22
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 222 648 9.0E-22
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 631 832 3.0E-21
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 222 601 5.0E-21
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 675 949 6.0E-20
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 325 590 9.0E-20
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 299 467 1.0E-19
sp|P95979|DPOL3_SULSO DNA polymerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo3 PE=3 SV=1 91 957 2.0E-19
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 107 465 7.0E-19
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 692 946 3.0E-18
sp|P26811|DPOL1_SULSO DNA polymerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo1 PE=1 SV=2 281 950 3.0E-18
sp|P33793|DPOL_VAR67 DNA polymerase OS=Variola virus (isolate Human/India/Ind3/1967) GN=POL PE=3 SV=1 484 852 1.0E-17
sp|O57191|DPOL_VACCA DNA polymerase OS=Vaccinia virus (strain Ankara) GN=POL PE=3 SV=1 484 852 1.0E-17
sp|P20509|DPOL_VACCC DNA polymerase OS=Vaccinia virus (strain Copenhagen) GN=POL PE=3 SV=1 484 852 1.0E-17
sp|P06856|DPOL_VACCW DNA polymerase OS=Vaccinia virus (strain Western Reserve) GN=POL PE=1 SV=5 484 852 2.0E-17
sp|O50607|DPOL1_SULOH DNA polymerase 1 OS=Sulfurisphaera ohwakuensis GN=pol-alpha PE=3 SV=1 174 818 3.0E-17
sp|P30318|DPOL_NPVLD DNA polymerase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=POL PE=3 SV=2 282 748 3.0E-17
sp|Q84173|DPOL_ORFN2 DNA polymerase OS=Orf virus (strain NZ2) GN=POL PE=3 SV=1 484 831 6.0E-17
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 577 753 8.0E-17
sp|Q83948|DPOL_NPVOP DNA polymerase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=POL PE=3 SV=1 269 892 1.0E-15
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 631 756 3.0E-15
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 127 617 1.0E-14
sp|P18131|DPOL_NPVAC DNA polymerase OS=Autographa californica nuclear polyhedrosis virus GN=POL PE=3 SV=2 281 774 1.0E-14
sp|P21402|DPOL_FOWPN DNA polymerase OS=Fowlpox virus (strain NVSL) GN=POL PE=3 SV=2 559 956 1.0E-14
sp|P95690|DPOL1_SULAC DNA polymerase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dpo1 PE=1 SV=2 341 792 1.0E-14
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 692 947 3.0E-14
sp|P41712|DPOL_NPVBM DNA polymerase OS=Bombyx mori nuclear polyhedrosis virus GN=POL PE=3 SV=2 281 776 3.0E-14
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 126 581 6.0E-14
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 692 947 8.0E-14
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 284 617 1.0E-13
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 286 617 1.0E-13
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 104 303 2.0E-13
sp|O93745|DPOL1_AERPE DNA polymerase 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polA PE=3 SV=2 368 791 3.0E-13
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 483 605 1.0E-12
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 103 303 2.0E-11
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 754 947 1.0E-09
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 720 946 1.0E-09
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 720 947 1.0E-09
sp|P04415|DPOL_BPT4 DNA polymerase OS=Enterobacteria phage T4 GN=43 PE=1 SV=1 345 751 1.0E-09
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 722 947 2.0E-09
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 701 947 5.0E-09
sp|Q38087|DPOL_BPR69 DNA polymerase OS=Enterobacteria phage RB69 GN=43 PE=1 SV=1 345 740 7.0E-09
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 228 502 3.0E-08
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 559 911 6.0E-08
sp|O26310|DPOL2_METTH DNA polymerase PolB subunit 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB2 PE=1 SV=1 761 966 3.0E-07
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 106 317 4.0E-07
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 577 679 6.0E-06
sp|Q07864|DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens GN=POLE PE=1 SV=5 220 575 6.0E-06
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 577 679 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094650
MPYSKKEKKPLERTKTLNGEEIEEGPAVKKRKLGNGASTLQGVQSQPSFADVLEKLKEEEGTNAPEAEGGANRWG
RPRLDEIDPDQDSIVFQQIDVEEGVDGNGHFGIRMYGVTQEGHSVMALITDFLPYFYIAVPRGFQDEDMTAFKGY
LNQTVGSNVVQKVEKFAKRTLWGYRGDDKVSFLKLTISDPKSLPRVRGLFERAECQFQGLFPSEPVPTFESNIVF
TLRFMIDTKVVGMNWIEVPPGKYKLVTSQHKRSHCQIELRMRYDAFISHPPEGAWSKIAPLRILSFDIECAGRKG
IFPEAQTDPVIQIANMVTRHGEDKPFIRNVFNLNTCANIVGSQVLTFTEEASLFQAWRDFVEEVDPDVITGYNIA
NFDFPYLMDRAKALEVANFNYLGRLRNVRTEVKNTHFSSRAYGQRDSKETPLYGRLQMDILQFMQREHKLRSYTL
NSVCAQFLGEQKEDVHHSVITELYNGTPESRRRLAVYCLKDAYLPQRLLDKLMCFVNYTEMARVTGVPFNYLLSR
GQSIKVLSQLFRKANEEGYVIPALKGEGTDGEAYEGATVIEPKKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLI
DGNMIEKLDLVKDVDYIQTPNNDFFVTSMKRKGLLPTILEDLISARKRAKADLKMEKDPFKKAVLDGRQLALKIS
ANSVYGFTGATVGKLPCLPISSSVTAYGRQMIEKTKQEVEAEFCIANGHQYDARVIYGDTDSVMVKFGQNDLAQV
MALGSEAAEFVSAKFIKPIKLEFEKVYYPYLLISKKRYAGLYWTKAEKYDKMDSKGIETVRRDNCRLVSTVIETS
LHKLLIDRDVKAAEIYVKQMIADLLQNKVDMSQLVITKALSKTDYAGKQAHVELAERMKQRDAGSAPALGDRVAY
VIIKGIKGAAAYEKSEDPLYVLENSIPIDTKYYLENQLSKPLMRIFEPILGEKASSLLSGDHTRTIQIATPTVGG
LMKFAVKTVTCLGCKTALKTNNSIANGAICNNCRPRISELYQKQVMSTSELQVRFARLWTQCQRCQGSLHQDVLC
TSKDCPIFYMRKKAQKDAEDANTALERFDDEAW*
Coding >AgabiH97|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACAAAAACACTGAACGGCGAGGAGATTGAAGAAGGT
CCAGCAGTAAAGAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCC
GATGTACTAGAAAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGAGGCGGAGGGTGGAGCAAACCGCTGGGGA
CGCCCAAGACTAGACGAAATCGATCCTGACCAGGACTCCATAGTGTTTCAGCAGATTGATGTGGAGGAAGGCGTT
GATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGAGGGCCACAGTGTTATGGCTTTAATCACA
GATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATAC
CTTAATCAAACCGTTGGTAGTAATGTTGTTCAAAAGGTGGAGAAATTTGCCAAGCGGACACTCTGGGGTTACAGA
GGGGATGATAAGGTTTCTTTCCTCAAGCTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGGTCTCTTT
GAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCTGTACCTACCTTCGAAAGCAATATTGTCTTC
ACACTTAGGTTCATGATCGATACGAAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAACTG
GTAACTTCACAACACAAACGATCTCACTGTCAGATTGAGCTACGTATGAGATACGACGCCTTTATTTCACATCCT
CCAGAAGGTGCTTGGTCAAAGATCGCTCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGG
ATTTTTCCCGAGGCTCAAACTGATCCTGTCATCCAGATTGCGAACATGGTGACGAGACACGGGGAAGATAAACCT
TTCATCCGCAACGTCTTCAACCTCAATACTTGCGCGAATATTGTTGGATCGCAAGTTTTGACCTTCACAGAAGAA
GCGTCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATGTGATAACTGGATACAACATCGCA
AATTTCGATTTTCCCTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCAACTTCAACTACTTGGGTCGTTTG
AGAAACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAACC
CCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTCTG
AATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAACTATACAAC
GGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGACGCATATCTGCCGCAGAGATTGTTGGAT
AAGCTTATGTGCTTCGTCAACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTCAATTATCTACTATCTCGT
GGCCAAAGTATCAAGGTACTTTCACAGCTGTTCAGAAAGGCAAACGAAGAAGGTTATGTCATTCCGGCATTAAAG
GGGGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTGATAGAACCGAAGAAAGGTTATTATGACGTGCCG
ATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATGATGGCGCACAATCTTTGTTACACCACACTGATC
GACGGAAACATGATCGAGAAACTGGATCTCGTGAAAGATGTCGACTACATCCAAACACCGAATAATGATTTCTTT
GTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGATCTCATTTCTGCTCGCAAGCGTGCGAAG
GCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGATTAGT
GCAAACTCAGTGTATGGTTTTACAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACG
GCTTATGGCCGTCAAATGATTGAGAAAACGAAACAAGAAGTCGAGGCCGAATTTTGTATCGCTAATGGGCACCAA
TATGACGCCCGGGTCATTTACGGAGATACTGATTCCGTCATGGTCAAGTTTGGGCAGAATGACCTTGCCCAAGTC
ATGGCTCTCGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCAAGCTTGAGTTCGAGAAG
GTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCAAGGCAGAAAAGTATGAC
AAGATGGACTCGAAGGGCATTGAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGT
CTTCACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATCTACGTTAAGCAAATGATTGCCGACCTGTTA
CAAAACAAGGTTGATATGTCTCAACTAGTGATCACAAAAGCACTGTCAAAAACGGACTATGCTGGAAAACAGGCA
CACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTGCACCAGCACTAGGAGATCGTGTTGCCTAT
GTCATAATCAAGGGTATAAAAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACGTTTTGGAAAACAGT
ATACCGATCGATACGAAATACTACCTCGAGAACCAGCTTTCAAAACCATTGATGAGAATTTTCGAACCTATTCTC
GGAGAAAAGGCTTCTTCTCTGTTGTCTGGTGACCATACAAGGACAATACAGATTGCGACACCCACTGTAGGTGGC
CTCATGAAATTCGCCGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCT
AATGGTGCTATCTGCAATAATTGTCGGCCCAGAATCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAG
CTACAGGTACGATTTGCACGATTGTGGACCCAGTGCCAGAGATGCCAGGGATCTCTACATCAGGATGTCTTGTGT
ACAAGCAAAGACTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCTGAGGATGCTAATACAGCCTTA
GAACGGTTTGATGACGAGGCTTGGTGA
Transcript >AgabiH97|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACAAAAACACTGAACGGCGAGGAGATTGAAGAAGGT
CCAGCAGTAAAGAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCC
GATGTACTAGAAAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGAGGCGGAGGGTGGAGCAAACCGCTGGGGA
CGCCCAAGACTAGACGAAATCGATCCTGACCAGGACTCCATAGTGTTTCAGCAGATTGATGTGGAGGAAGGCGTT
GATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGAGGGCCACAGTGTTATGGCTTTAATCACA
GATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATAC
CTTAATCAAACCGTTGGTAGTAATGTTGTTCAAAAGGTGGAGAAATTTGCCAAGCGGACACTCTGGGGTTACAGA
GGGGATGATAAGGTTTCTTTCCTCAAGCTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGGTCTCTTT
GAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCTGTACCTACCTTCGAAAGCAATATTGTCTTC
ACACTTAGGTTCATGATCGATACGAAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAACTG
GTAACTTCACAACACAAACGATCTCACTGTCAGATTGAGCTACGTATGAGATACGACGCCTTTATTTCACATCCT
CCAGAAGGTGCTTGGTCAAAGATCGCTCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGG
ATTTTTCCCGAGGCTCAAACTGATCCTGTCATCCAGATTGCGAACATGGTGACGAGACACGGGGAAGATAAACCT
TTCATCCGCAACGTCTTCAACCTCAATACTTGCGCGAATATTGTTGGATCGCAAGTTTTGACCTTCACAGAAGAA
GCGTCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATGTGATAACTGGATACAACATCGCA
AATTTCGATTTTCCCTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCAACTTCAACTACTTGGGTCGTTTG
AGAAACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAACC
CCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTCTG
AATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAACTATACAAC
GGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGACGCATATCTGCCGCAGAGATTGTTGGAT
AAGCTTATGTGCTTCGTCAACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTCAATTATCTACTATCTCGT
GGCCAAAGTATCAAGGTACTTTCACAGCTGTTCAGAAAGGCAAACGAAGAAGGTTATGTCATTCCGGCATTAAAG
GGGGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTGATAGAACCGAAGAAAGGTTATTATGACGTGCCG
ATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATGATGGCGCACAATCTTTGTTACACCACACTGATC
GACGGAAACATGATCGAGAAACTGGATCTCGTGAAAGATGTCGACTACATCCAAACACCGAATAATGATTTCTTT
GTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGATCTCATTTCTGCTCGCAAGCGTGCGAAG
GCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGATTAGT
GCAAACTCAGTGTATGGTTTTACAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACG
GCTTATGGCCGTCAAATGATTGAGAAAACGAAACAAGAAGTCGAGGCCGAATTTTGTATCGCTAATGGGCACCAA
TATGACGCCCGGGTCATTTACGGAGATACTGATTCCGTCATGGTCAAGTTTGGGCAGAATGACCTTGCCCAAGTC
ATGGCTCTCGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCAAGCTTGAGTTCGAGAAG
GTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCAAGGCAGAAAAGTATGAC
AAGATGGACTCGAAGGGCATTGAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGT
CTTCACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATCTACGTTAAGCAAATGATTGCCGACCTGTTA
CAAAACAAGGTTGATATGTCTCAACTAGTGATCACAAAAGCACTGTCAAAAACGGACTATGCTGGAAAACAGGCA
CACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTGCACCAGCACTAGGAGATCGTGTTGCCTAT
GTCATAATCAAGGGTATAAAAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACGTTTTGGAAAACAGT
ATACCGATCGATACGAAATACTACCTCGAGAACCAGCTTTCAAAACCATTGATGAGAATTTTCGAACCTATTCTC
GGAGAAAAGGCTTCTTCTCTGTTGTCTGGTGACCATACAAGGACAATACAGATTGCGACACCCACTGTAGGTGGC
CTCATGAAATTCGCCGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCT
AATGGTGCTATCTGCAATAATTGTCGGCCCAGAATCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAG
CTACAGGTACGATTTGCACGATTGTGGACCCAGTGCCAGAGATGCCAGGGATCTCTACATCAGGATGTCTTGTGT
ACAAGCAAAGACTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCTGAGGATGCTAATACAGCCTTA
GAACGGTTTGATGACGAGGCTTGGTGA
Gene >AgabiH97|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACAAAGTGCGTCAACTTCCCGTATTTTGCGTGCTTA
TTCTTTCCCGCTAAGTCGACGCTGCTTAATCAGAACACTGAACGGCGAGGAGATTGAAGAAGGTCCAGCAGTAAA
GAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCCGATGTACTAGA
AAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGGTATGGTTGGCCTTTCGTGTAGTGAAAAGTCAGCTTATTC
TCAGGAAATTTGTAGAGGCGGAGGGTGGAGCAAACCGCTGGGGACGCCCAAGACTAGACGAAATCGATCCTGACC
AGGACTCCATAGGTCAATCTATCGAATTCTTCTCTATCCAGATTCCGCTGACATTCCTCAGTGTTTCAGCAGATT
GATGTGGAGGAAGGCGTTGATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGTAAGCTCCCCA
TGCAGCATCTTTTGAATCCTCTTTTCTGATCATTCGTTGTTCAGGAGGGCCACAGTGTTATGGCTTTAATCACAG
ATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATACC
TTAATGTGGGTCAACAAGAGTCGTGATTCGTTTGCTCTTACTCAAATAGTGAAGCAAACCGTTGGTAGTAATGTT
GTTCAAAAGGTGGAGAAATTTGCCAAGCGGACACTCTGGGGTTACAGAGGGGATGATAAGGTTTCTTTCCTCAAG
CTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGATGAGTAATTTGGTCCAGCCTCGTATGGCCCTTCA
AACTTATACGCCGGCTCTTTACGTCTCTTTGAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCT
GTACCTACCTTCGAAAGCAATATTGTCTTCACACTTAGGTTCATGATCGATACGAAGGTAACTGATTTATCGTTG
CATCTCCTCAGGTATTAACATCCCTTAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAACT
GGTAACTTCACAACACAAACGATCTCACTGTCAGATTGAGCTACGTATGAGGTAGGATCATTTTTAAATTCAGCA
GTTTCGAGCTTCATGGTTTCACAGATACGACGCCTTTATTTCACATCCTCCAGAAGGTGCTTGGTCAAAGATCGC
TCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGGATTTTTCCCGAGGCTCAAACTGATCC
TGTCATCCAGATTGCGAACATGGTGACGAGACACGGTAACTTCCAGCATTAATTCGATTGCTGGCTCTAGTTAAT
TGCTGACAGGGGAAGATAAACCTTTCATCCGCAACGTCTTCAACCTCAATACTTGCGCGAATATTGTTGGATCGC
AAGTTTTGACCTTCACAGAAGAAGCGTCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATG
TGATAACTGGATACAACATCGCAAATTTCGATTTTCCCTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCA
ACTTCAACTACTTGGGTCGTTTGAGAAGTGCGCACCAAGCTTTGACGGCTCGAACTGTTATGCTGAAATCGTTCT
CTCTAGACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAA
CCCCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTC
TGAATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAACTATACA
ACGGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGTATGTATTAGCGAATTTATTCTAGATT
CGATAACTTGACCATCATGTTGGGTAGGACGCATATCTGCCGCAGAGATTGTTGGATAAGCTTATGTGCTTCGTC
AACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTCAATTATCTACTATCTCGTGGCCAAAGTATCAAGGTA
CTTTCACAGCTGTTCAGAAAGGCAAACGAAGAAGGTTATGTCATTCCGGCATTAAAGGGGGAAGGTGAGGGGTAA
TCCTATTATGATATAATGCCGACTTCTTCACATCTTGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTG
ATAGAACCGAAGAAAGGTTATTATGACGTGCCGATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATG
ATGGCGCACAATCTTTGTTACACCACACTGATCGACGGAAACATGATCGAGAAACTGGATCTCGTGAAAGATGTC
GACTACATCCAAACACCGAATAATGGTAGGTACTTGAGGACTTATTTTTTTATCTGTTCTAACTTCGGCTAGATT
TCTTTGTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGATCTCATTTCTGCTCGCAAGCGTG
CGAAGGCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGG
TATACAGGATTGCTTCCAAGATGCAGCATAGGTATTGATTTTGAATAGATTAGTGCAAACTCAGTGTATGGTTTT
ACAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACGGCTTATGGCCGTCAAATGATT
GAGAAAACGAAACAAGTATGCTGACTTCTCTTTTCCCGGAAAGCCAAAAGGAGATTGACGGGCATAACAGGAAGT
CGAGGCCGAATTTTGTATCGCTAATGGGCACCAATATGACGCCCGGGTCATTTACGGAGATACTGATTCCGTCAT
GGTCAAGTTTGGGCAGAATGACCTTGCCCAAGTCATGGCTCTCGGTATGCAGTTCGATTTTCTGGCAAATAATTC
GTCACCAATAGGCGCAATCATTTCTAGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCA
AGCTTGAGTTCGAGAAGGTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCA
AGGCAGAAAAGTATGACAAGATGGACTCGAAGGGCATTGAGGTATGTGATTGATGGTTTCATGAATAGTTAACAT
TTGGATGATGAAAATCCTTAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGTCTT
CACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATGTTCGTTCCTATGTCTACGCCACAAAACCGTGCT
TGATCTTCTCATTTCAGCTACGTTAAGCAAATGATTGCCGACCTGTTACAAAACAAGGTTGATATGTCTCAACTA
GTGATCACAAAAGCACTGTCAAAAACGGGTCAGTCTAACAGAGCATAAAGCCTGGATTGCAATTGAAATGAACTT
CGAATACAGACTATGCTGGAAAACAGGCACACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTG
CACCAGCACTAGGAGATCGTGTTGCCTATGTCATAATCAAGGGTATAAAAGGTGCACCTTATCGCATATGGAAAA
GATGATTTCGCAAGCTAATTCTGACTTCATCAACAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACG
TTTTGGAAAACAGTATACCGATCGATACGAAATACTACCTCGAGAACCAGCTTTCAAAACCATTGATGAGAATTT
TCGAACCTATTCTCGGAGAAAAGGCTTCTTCTCTGTGTAAGCCCTTGACACTTGTTTTGAAAGGAGTTCTGACAA
GTTCAATAGTGTCTGGTGACCATACAAGGACAATACAGATTGCGACACCCACTGTAGGTGGCCTCATGAAATTCG
CCGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCTAGTGAGTTTCTAT
ACGGTTGTGTTCGCCGGCCTTGATCTGAGGCACTTGCAATTAGATGGTGCTATCTGCAATAATTGTCGGCCCAGA
ATCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAGCTACAGGTACGATTTGCACGATTGTGGACCCAG
TGCCAGAGATGCCAGGGATCTCTACATCAGGTATATCGTGAATTTTTCGGTATGATTATATCAATGCTAAGAGTG
CGTAGGATGTCTTGTGTACAAGCAAAGACTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCTGAGG
ATGCTAATACAGCCTTAGAACGGTTTGATGACGAGGCTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail