Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094620
Gene name
Locationscaffold_6:1629315..1630408
Strand+
Gene length (bp)1093
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03332 PMM Eukaryotic phosphomannomutase 5.9E-104 33 253
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 8.2E-07 15 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTJ2|PMM_SCHPO Phosphomannomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmm1 PE=2 SV=1 12 253 5.0E-121
sp|P31353|PMM_CANAL Phosphomannomutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMM1 PE=3 SV=1 1 253 9.0E-115
sp|P07283|PMM_YEAST Phosphomannomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC53 PE=1 SV=1 4 253 2.0E-109
sp|Q1W374|PMM_WHEAT Phosphomannomutase OS=Triticum aestivum PE=2 SV=1 1 254 3.0E-98
sp|Q7XPW5|PMM_ORYSJ Phosphomannomutase OS=Oryza sativa subsp. japonica GN=PMM PE=2 SV=2 12 254 5.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTJ2|PMM_SCHPO Phosphomannomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmm1 PE=2 SV=1 12 253 5.0E-121
sp|P31353|PMM_CANAL Phosphomannomutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMM1 PE=3 SV=1 1 253 9.0E-115
sp|P07283|PMM_YEAST Phosphomannomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC53 PE=1 SV=1 4 253 2.0E-109
sp|Q1W374|PMM_WHEAT Phosphomannomutase OS=Triticum aestivum PE=2 SV=1 1 254 3.0E-98
sp|Q7XPW5|PMM_ORYSJ Phosphomannomutase OS=Oryza sativa subsp. japonica GN=PMM PE=2 SV=2 12 254 5.0E-98
sp|Q259G4|PMM_ORYSI Phosphomannomutase OS=Oryza sativa subsp. indica GN=PMM PE=3 SV=1 12 254 5.0E-98
sp|O80840|PMM_ARATH Phosphomannomutase OS=Arabidopsis thaliana GN=PMM PE=1 SV=1 12 254 2.0E-97
sp|Q60HD6|PMM2_MACFA Phosphomannomutase 2 OS=Macaca fascicularis GN=PMM2 PE=2 SV=1 9 253 1.0E-96
sp|Q1W375|PMM_TOBAC Phosphomannomutase OS=Nicotiana tabacum PE=2 SV=1 8 254 2.0E-95
sp|O15305|PMM2_HUMAN Phosphomannomutase 2 OS=Homo sapiens GN=PMM2 PE=1 SV=1 9 253 4.0E-95
sp|Q1W376|PMM_SOYBN Phosphomannomutase OS=Glycine max PE=2 SV=1 8 254 7.0E-95
sp|Q92871|PMM1_HUMAN Phosphomannomutase 1 OS=Homo sapiens GN=PMM1 PE=1 SV=2 8 253 4.0E-93
sp|Q1W377|PMM_SOLLC Phosphomannomutase OS=Solanum lycopersicum PE=2 SV=1 8 254 5.0E-93
sp|Q3SZJ9|PMM2_BOVIN Phosphomannomutase 2 OS=Bos taurus GN=PMM2 PE=2 SV=1 9 254 2.0E-92
sp|O35621|PMM1_MOUSE Phosphomannomutase 1 OS=Mus musculus GN=Pmm1 PE=1 SV=1 8 253 5.0E-92
sp|Q9Z2M7|PMM2_MOUSE Phosphomannomutase 2 OS=Mus musculus GN=Pmm2 PE=1 SV=1 12 253 9.0E-90
sp|Q54X03|PMM1_DICDI Phosphomannomutase 1 OS=Dictyostelium discoideum GN=pmmA PE=3 SV=1 11 253 1.0E-89
sp|Q86B09|PMM2_DICDI Phosphomannomutase 2 OS=Dictyostelium discoideum GN=pmmB PE=3 SV=2 10 254 3.0E-88
sp|Q8SVM5|PMM_ENCCU Phosphomannomutase OS=Encephalitozoon cuniculi (strain GB-M1) GN=SEC53 PE=1 SV=1 8 247 3.0E-82
sp|Q9VTZ6|PMM_DROME Probable phosphomannomutase OS=Drosophila melanogaster GN=CG10688 PE=2 SV=1 13 251 5.0E-81
sp|Q9XUE6|PMM_CAEEL Probable phosphomannomutase OS=Caenorhabditis elegans GN=F52B11.2 PE=3 SV=2 12 251 5.0E-80
sp|O43976|PMM_BABBO Phosphomannomutase OS=Babesia bovis GN=PMM PE=2 SV=1 13 251 9.0E-58
[Show less]

GO

GO Term Description Terminal node
GO:0009298 GDP-mannose biosynthetic process Yes
GO:0004615 phosphomannomutase activity Yes
GO:0008150 biological_process No
GO:0009225 nucleotide-sugar metabolic process No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0019673 GDP-mannose metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016868 intramolecular transferase activity, phosphotransferases No
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009226 nucleotide-sugar biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016853 isomerase activity No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094620
MSKSFKDRPRNALCLFDVDGTLTLARQGASKEMIDTLRQLRKNVAVGFVSGSDLAKIIEQLETNGFNVINDLDYA
FAENGLSAYKLGQLLPSESFINFVGEEKYKVLVNFILHYLADMDIPIKRGTFIEFRRGMINVSPIGRNATIKERI
EFEKLDKEKRYREKFVQVLREKFSDYGLTFSIGGQISFDVFPNGWDKRYALRRVEDEGFDEIHFFGDKTFEGGND
YEIFADPRTIGHSVNNPEDTIRILKEQFL*
Coding >AgabiH97|094620
ATGTCTAAAAGCTTCAAAGACAGGCCCCGCAACGCCCTCTGCCTCTTCGATGTTGACGGCACACTTACACTAGCC
CGTCAGGGTGCATCCAAGGAGATGATTGATACCCTTCGTCAACTACGCAAAAACGTAGCCGTTGGATTTGTTAGT
GGCTCCGATCTTGCCAAAATAATCGAACAACTCGAGACAAATGGGTTCAACGTCATTAATGACCTCGATTATGCG
TTTGCTGAGAACGGTCTCTCAGCGTACAAACTCGGTCAACTTCTCCCTTCTGAATCGTTTATCAATTTTGTTGGG
GAGGAAAAGTACAAGGTCCTGGTAAACTTCATCCTTCACTACCTTGCCGATATGGACATTCCCATAAAACGTGGA
ACTTTTATTGAATTCCGTCGGGGAATGATCAACGTCAGTCCCATTGGCCGTAACGCGACTATTAAAGAGCGAATA
GAGTTCGAAAAGTTAGACAAGGAAAAACGGTATCGCGAAAAATTCGTCCAGGTTCTCAGGGAAAAATTCTCCGAC
TACGGACTTACGTTTTCCATCGGTGGTCAAATTTCTTTCGACGTCTTTCCTAATGGATGGGACAAGAGGTACGCG
CTTCGTAGGGTAGAAGACGAGGGTTTCGACGAAATTCATTTCTTTGGCGATAAAACATTCGAGGGAGGGAATGAC
TATGAGATCTTCGCCGACCCTCGGACGATAGGACACTCCGTCAACAACCCTGAAGACACTATTCGCATCCTCAAA
GAACAATTCCTTTAA
Transcript >AgabiH97|094620
ATGTCTAAAAGCTTCAAAGACAGGCCCCGCAACGCCCTCTGCCTCTTCGATGTTGACGGCACACTTACACTAGCC
CGTCAGGGTGCATCCAAGGAGATGATTGATACCCTTCGTCAACTACGCAAAAACGTAGCCGTTGGATTTGTTAGT
GGCTCCGATCTTGCCAAAATAATCGAACAACTCGAGACAAATGGGTTCAACGTCATTAATGACCTCGATTATGCG
TTTGCTGAGAACGGTCTCTCAGCGTACAAACTCGGTCAACTTCTCCCTTCTGAATCGTTTATCAATTTTGTTGGG
GAGGAAAAGTACAAGGTCCTGGTAAACTTCATCCTTCACTACCTTGCCGATATGGACATTCCCATAAAACGTGGA
ACTTTTATTGAATTCCGTCGGGGAATGATCAACGTCAGTCCCATTGGCCGTAACGCGACTATTAAAGAGCGAATA
GAGTTCGAAAAGTTAGACAAGGAAAAACGGTATCGCGAAAAATTCGTCCAGGTTCTCAGGGAAAAATTCTCCGAC
TACGGACTTACGTTTTCCATCGGTGGTCAAATTTCTTTCGACGTCTTTCCTAATGGATGGGACAAGAGGTACGCG
CTTCGTAGGGTAGAAGACGAGGGTTTCGACGAAATTCATTTCTTTGGCGATAAAACATTCGAGGGAGGGAATGAC
TATGAGATCTTCGCCGACCCTCGGACGATAGGACACTCCGTCAACAACCCTGAAGACACTATTCGCATCCTCAAA
GAACAATTCCTTTAA
Gene >AgabiH97|094620
ATGTCTAAAAGCTTCAAAGACAGGCCCCGCAACGCCCTCTGCCTCTTCGATGTTGACGGCACACTTACACTAGCC
CGTCAGGTCCGTCATTTCATACTCTTCCCTGTATGCGATCCTTGACTGCTCAGCCTACTAGGGTGCATCCAAGGA
GATGATTGATACCCTTCGTCAACTACGCAAAAACGTAGCCGTTGGATTTGTTAGTGGCTCCGATCTTGCCAAAAT
AATCGAACAACTCGAGACAAATGGGTTCAACGGTACTGATAACCTACCTGTATCCATACCCTGTCTATTATCTAA
CTGTCAGATTTGCAGTCATTAATGACCTCGATTATGCGTTTGCTGAGAACGGTCTCTCAGCGTACAAACTCGGTC
AACTTCTCCCTTCTGAATCGTTTATCAATTTTGTTGGGGAGGAAAAGTACAAGGTCCTGGTAAACTTCATCCTTC
ACTACCTTGCCGATATGGACATTCCCATAAAACGGTAAAAGATACCCTTTCCAAACAGACTACACCGAGGCACTG
AGATTTGATTTTTCGAAGTGGAACTTTTATTGAATTCCGTCGGGGAATGATCAACGTCAGTCCCATTGGCCGTAA
CGCGACGTCAGTCCTACTAATTCTGTAATCTACCCGAACACTCATGAAAGTCTACCTAGTATTAAAGAGCGAATA
GAGTTCGAAAAGTTAGACAAGGTACCCACAAAGATATATGCGATAGGAAAGCCGCAAACGTATATTTCATAATTT
AGGAAAAACGGTATCGCGAAAAATTCGTCCAGGTTCTCAGGGAAAAATTCTCCGACTACGGACTTACGTTTTCCA
TCGGTGGTCAAATTTCTTTCGACGTCTTTCCTAATGGATGGGACAAGAGGTACGCGCTTCGTAGGGTAGAAGACG
AGGGTTTCGACGAAATTCATTTCTTTGGCGATAAAACATTCGAGGTCAGTGCGGCTACTCCTGGGCAACCATATT
TAATCATCCGATCTAGGGAGGGAATGACTATGAGATCTTCGCCGACCCTCGGACGATAGGACACTCCGTCAACAA
CCCTGAAGACACTATTCGCATCCTCAAAGAACAATTCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail