Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094560
Gene name
Locationscaffold_6:1615631..1616679
Strand+
Gene length (bp)1048
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07719 TPR_2 Tetratricopeptide repeat 5.6E-06 82 113
PF13414 TPR_11 TPR repeat 1.4E-06 92 125
PF00515 TPR_1 Tetratricopeptide repeat 1.0E-06 81 113
PF13432 TPR_16 Tetratricopeptide repeat 8.2E-06 53 115
PF13181 TPR_8 Tetratricopeptide repeat 2.5E-02 81 113
PF13429 TPR_15 Tetratricopeptide repeat 2.5E-06 44 172

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094560
MYFARLARSFAATARRPTTTRPAFRPSRRWATSVTPHSTASDPAETEAVRCMEQGTAKLEEGDVQAAKELYKRSA
SIKRNASSLFNLGVTHYHLKEYDDAIAAWKESVTLQPSSPDAHINLASAYIISPVPRPDLALHHLEIASSLSPED
PEIAFNHAAVLEATGKLDEALEKYKLSKQFGVERAAVHIRNVSAKIFGQKMKQAENSPGTPDDKTS*
Coding >AgabiH97|094560
ATGTATTTTGCCCGCCTAGCCCGTTCCTTTGCCGCCACCGCGCGCCGTCCAACGACAACAAGGCCAGCATTCAGA
CCGTCTAGACGATGGGCTACTTCCGTCACCCCCCATTCGACCGCATCCGACCCGGCGGAAACAGAGGCAGTCCGC
TGTATGGAGCAGGGTACAGCGAAGCTCGAGGAGGGCGATGTTCAAGCCGCAAAAGAACTTTATAAACGCAGCGCC
AGCATCAAGAGGAATGCAAGCTCGCTTTTCAACCTTGGTGTCACGCACTACCATCTTAAGGAATATGATGATGCG
ATTGCAGCGTGGAAAGAGTCAGTTACGCTGCAGCCATCCAGTCCAGACGCGCACATAAACCTTGCAAGCGCTTAC
ATCATTTCACCTGTTCCTCGTCCGGATCTTGCGCTCCACCACCTCGAGATTGCTTCATCTCTCTCTCCCGAAGAT
CCAGAAATAGCTTTCAATCACGCCGCTGTGTTGGAAGCCACCGGTAAATTGGACGAGGCTCTCGAAAAGTACAAG
CTTAGCAAGCAATTCGGCGTCGAACGCGCCGCCGTTCACATACGCAACGTCAGCGCAAAAATCTTTGGGCAGAAA
ATGAAGCAAGCGGAGAATTCGCCAGGAACACCCGACGATAAGACTTCATGA
Transcript >AgabiH97|094560
ATGTATTTTGCCCGCCTAGCCCGTTCCTTTGCCGCCACCGCGCGCCGTCCAACGACAACAAGGCCAGCATTCAGA
CCGTCTAGACGATGGGCTACTTCCGTCACCCCCCATTCGACCGCATCCGACCCGGCGGAAACAGAGGCAGTCCGC
TGTATGGAGCAGGGTACAGCGAAGCTCGAGGAGGGCGATGTTCAAGCCGCAAAAGAACTTTATAAACGCAGCGCC
AGCATCAAGAGGAATGCAAGCTCGCTTTTCAACCTTGGTGTCACGCACTACCATCTTAAGGAATATGATGATGCG
ATTGCAGCGTGGAAAGAGTCAGTTACGCTGCAGCCATCCAGTCCAGACGCGCACATAAACCTTGCAAGCGCTTAC
ATCATTTCACCTGTTCCTCGTCCGGATCTTGCGCTCCACCACCTCGAGATTGCTTCATCTCTCTCTCCCGAAGAT
CCAGAAATAGCTTTCAATCACGCCGCTGTGTTGGAAGCCACCGGTAAATTGGACGAGGCTCTCGAAAAGTACAAG
CTTAGCAAGCAATTCGGCGTCGAACGCGCCGCCGTTCACATACGCAACGTCAGCGCAAAAATCTTTGGGCAGAAA
ATGAAGCAAGCGGAGAATTCGCCAGGAACACCCGACGATAAGACTTCATGA
Gene >AgabiH97|094560
ATGTATTTTGCCCGCCTAGCCCGTTCCTTTGCCGCCACCGCGCGCCGTCCAACGACAACAAGGCCAGCATTCAGA
CCGTCTAGACGTATGTTATTATTTGTTTTTTGCCTCTGACTTTAATAATGACCGCCGTCCAGGATGGGCTACTTC
CGTCACCCCCCATTCGACCGCATCCGACCCGGCGGAAACAGAGGCAGTCCGCTGTATGGAGCAGGGTACAGCGAA
GCTCGAGGAGGGCGATGTTCAAGCCGCAAAAGAACTTTATAAACGCAGCGCCAGCATCAAGAGGAATGCAAGCTC
GCTTTTCAACCTTGGTGTCACGCACTACCATCTTAGTTCGCGCATCTTCCTCTTATTCGTTTTTTCCATTAGCTG
ATATATCCCCAGAGGAATATGATGATGCGATTGCAGCGTGGAAAGAGTCAGTTACGCTGCAGCCATCCAGTCCAG
ACGCGCACATAAGTATGTCCACGCTTGCCTACATGGGCTAGTGATACTCATATCCTTAGACCTTGCAAGCGCTTA
CATCATTTCACCTGGTGTGTCTTCTCCAAAATTCGCTCCCACATCGACGTAACTTCTTTAAAAAAACTTAGTTCC
TCGTCCGGATCTTGCGCTCCACCACCTCGAGTACAACAGCTTGCCTCATCGCCGTGTCAATCAATTGACGCAGTA
ACCAACAGGATTGCTTCATCTCTCTCTCCCGAAGATCCAGAAATAGCTTTCAATCACGCCGCTGTGTTGGAAGCC
AGTCAGTTCGGCTTCTCTCTGTCTCGTATTGTTTTCTAATCTTAGCATGATCGTATTCCCTCCAGCCGGTAAATT
GGACGAGGCTCTCGAAAAGTACAAGCTTAGCAAGCAATTCGGCGTCGAACGCGCCGCCGTTCACATACGCAACGT
AAGCAATCTCAAAACATTATCCTTTCGATTACCATTCAGCCACCAAACATATTAATGAAATATACCTTAGGTCAG
CGCAAAAATCTTTGGGCAGAAAATGAAGCAAGCGGAGAATTCGCCAGGAACACCCGACGATAAGACTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail