Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094470
Gene name
Locationscaffold_6:1598826..1600974
Strand-
Gene length (bp)2148
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01425 Amidase Amidase 1.9E-74 57 518

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B3C8|A2965_ARTBC Putative amidase ARB_02965 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02965 PE=1 SV=1 33 552 2.0E-120
sp|Q9URY4|YI01_SCHPO Putative amidase C869.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.01 PE=3 SV=1 36 545 7.0E-79
sp|B9LER8|GATA_CHLSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gatA PE=3 SV=1 35 536 9.0E-46
sp|A9WCD8|GATA_CHLAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gatA PE=3 SV=1 35 536 9.0E-46
sp|C6E6Z2|GATA_GEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sp. (strain M21) GN=gatA PE=3 SV=1 35 536 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B3C8|A2965_ARTBC Putative amidase ARB_02965 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02965 PE=1 SV=1 33 552 2.0E-120
sp|Q9URY4|YI01_SCHPO Putative amidase C869.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.01 PE=3 SV=1 36 545 7.0E-79
sp|B9LER8|GATA_CHLSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gatA PE=3 SV=1 35 536 9.0E-46
sp|A9WCD8|GATA_CHLAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gatA PE=3 SV=1 35 536 9.0E-46
sp|C6E6Z2|GATA_GEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sp. (strain M21) GN=gatA PE=3 SV=1 35 536 9.0E-46
sp|B5ED19|GATA_GEOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatA PE=3 SV=1 35 536 2.0E-45
sp|Q88XP7|GATA_LACPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gatA PE=3 SV=1 37 531 2.0E-45
sp|Q97FQ7|GATA1_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA1 PE=3 SV=1 35 531 4.0E-44
sp|A1ATL3|GATA_PELPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter propionicus (strain DSM 2379) GN=gatA PE=3 SV=1 35 531 7.0E-44
sp|Q3A2K0|GATA_PELCD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatA PE=3 SV=1 36 530 1.0E-43
sp|B0K3S3|GATA_THEPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter sp. (strain X514) GN=gatA PE=3 SV=1 35 531 3.0E-43
sp|B9LZ18|GATA_GEODF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatA PE=3 SV=1 35 539 4.0E-43
sp|B1INF7|GATA_CLOBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Okra / Type B1) GN=gatA PE=3 SV=1 35 539 4.0E-43
sp|A5G9J9|GATA_GEOUR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter uraniireducens (strain Rf4) GN=gatA PE=3 SV=1 35 530 5.0E-43
sp|B3EA24|GATA_GEOLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatA PE=3 SV=1 35 539 6.0E-43
sp|B0KBN4|GATA_THEP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatA PE=3 SV=1 35 531 6.0E-43
sp|A5I6Z3|GATA_CLOBH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatA PE=3 SV=1 35 539 8.0E-43
sp|A7FYL3|GATA_CLOB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatA PE=3 SV=1 35 539 8.0E-43
sp|A7GIK2|GATA_CLOBL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatA PE=3 SV=1 35 539 1.0E-42
sp|B0JSX3|GATA_MICAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Microcystis aeruginosa (strain NIES-843) GN=gatA PE=3 SV=1 40 530 2.0E-42
sp|Q97EX8|GATA2_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA2 PE=3 SV=1 35 528 3.0E-42
sp|B1L1G9|GATA_CLOBM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatA PE=3 SV=1 35 539 3.0E-42
sp|C3KU97|GATA_CLOB6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatA PE=3 SV=1 35 539 6.0E-42
sp|Q60CK8|GATA_METCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatA PE=3 SV=1 36 530 6.0E-42
sp|B8G974|GATA_CHLAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gatA PE=3 SV=1 35 536 7.0E-42
sp|P73558|GATA_SYNY3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatA PE=3 SV=1 45 530 8.0E-42
sp|Q8RC40|GATA_CALS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatA PE=3 SV=1 35 531 9.0E-42
sp|C1FLD9|GATA_CLOBJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatA PE=3 SV=1 35 539 1.0E-41
sp|Q891I1|GATA_CLOTE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium tetani (strain Massachusetts / E88) GN=gatA PE=3 SV=1 35 531 2.0E-41
sp|Q67KJ2|GATA_SYMTH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatA PE=3 SV=1 50 541 3.0E-41
sp|A0LP22|GATA_SYNFM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gatA PE=3 SV=1 37 543 4.0E-41
sp|Q39ZK0|GATA_GEOMG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatA PE=3 SV=1 35 530 7.0E-41
sp|Q1GYD3|GATA_METFK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatA PE=3 SV=1 40 534 1.0E-40
sp|B0VEN3|GATA_ACIBY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AYE) GN=gatA PE=3 SV=1 35 541 2.0E-40
sp|B2HY00|GATA_ACIBC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ACICU) GN=gatA PE=3 SV=1 35 541 2.0E-40
sp|B7GXC5|GATA_ACIB3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB307-0294) GN=gatA PE=3 SV=1 35 541 2.0E-40
sp|B7I7N2|GATA_ACIB5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB0057) GN=gatA PE=3 SV=1 35 541 5.0E-40
sp|Q2RGY4|GATA_MOOTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moorella thermoacetica (strain ATCC 39073) GN=gatA PE=3 SV=1 35 536 6.0E-40
sp|A3M8F1|GATA_ACIBT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gatA PE=3 SV=2 35 541 7.0E-40
sp|B0VS13|GATA_ACIBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain SDF) GN=gatA PE=3 SV=1 35 541 8.0E-40
sp|A6TTJ8|GATA_ALKMQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=gatA PE=3 SV=1 38 528 8.0E-40
sp|Q8DK65|GATA_THEEB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermosynechococcus elongatus (strain BP-1) GN=gatA PE=3 SV=2 41 530 9.0E-40
sp|Q746Y7|GATA_GEOSL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatA PE=3 SV=1 35 531 2.0E-39
sp|B1HTW9|GATA_LYSSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lysinibacillus sphaericus (strain C3-41) GN=gatA PE=3 SV=1 36 531 3.0E-39
sp|B1WYP3|GATA_CYAA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain ATCC 51142) GN=gatA PE=3 SV=1 40 530 3.0E-39
sp|A8I9X6|GATA_AZOC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatA PE=3 SV=1 36 529 4.0E-39
sp|C4L690|GATA_EXISA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=gatA PE=3 SV=1 36 529 6.0E-39
sp|B8HY89|GATA_CYAP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gatA PE=3 SV=1 39 530 6.0E-39
sp|Q4KIA8|GATA_PSEF5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatA PE=3 SV=1 36 356 7.0E-39
sp|Q03Q16|GATA_LACBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gatA PE=3 SV=1 35 534 8.0E-39
sp|B1XJG8|GATA_SYNP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatA PE=3 SV=1 39 530 1.0E-38
sp|Q0BTK2|GATA_GRABC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatA PE=3 SV=1 36 529 1.0E-38
sp|Q31F53|GATA_THICR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiomicrospira crunogena (strain XCL-2) GN=gatA PE=3 SV=1 36 530 2.0E-38
sp|A5GTM0|GATA_SYNR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain RCC307) GN=gatA PE=3 SV=1 66 540 3.0E-38
sp|A5UXF9|GATA_ROSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus sp. (strain RS-1) GN=gatA PE=3 SV=1 36 530 4.0E-38
sp|B0TDK7|GATA_HELMI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gatA PE=3 SV=1 36 530 4.0E-38
sp|B7KLL5|GATA_CYAP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7424) GN=gatA PE=3 SV=1 39 530 5.0E-38
sp|B4UIV1|GATA_ANASK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter sp. (strain K) GN=gatA PE=3 SV=1 35 528 8.0E-38
sp|B8JBQ1|GATA_ANAD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatA PE=3 SV=1 35 528 1.0E-37
sp|Q6FDY3|GATA_ACIAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gatA PE=3 SV=1 35 541 1.0E-37
sp|Q3AD36|GATA_CARHZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatA PE=3 SV=1 35 350 1.0E-37
sp|Q2LXM9|GATA_SYNAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophus aciditrophicus (strain SB) GN=gatA PE=3 SV=1 35 528 2.0E-37
sp|Q2IH94|GATA_ANADE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatA PE=3 SV=1 35 528 2.0E-37
sp|Q1DCA3|GATA_MYXXD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Myxococcus xanthus (strain DK 1622) GN=gatA PE=3 SV=1 36 528 2.0E-37
sp|A9B9W7|GATA_PROM4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9211) GN=gatA PE=3 SV=1 40 529 2.0E-37
sp|Q1J0C2|GATA_DEIGD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus geothermalis (strain DSM 11300) GN=gatA PE=3 SV=1 76 482 3.0E-37
sp|Q3ZYM5|GATA_DEHMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatA PE=3 SV=1 35 530 3.0E-37
sp|A5FQ07|GATA_DEHMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gatA PE=3 SV=1 35 530 3.0E-37
sp|Q3KI27|GATA_PSEPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatA PE=3 SV=1 36 356 4.0E-37
sp|B8FCK9|GATA_DESAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatA PE=3 SV=1 36 536 4.0E-37
sp|A6W7L7|GATA_KINRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gatA PE=3 SV=1 30 345 4.0E-37
sp|B2V855|GATA_SULSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gatA PE=3 SV=1 35 313 5.0E-37
sp|A2C1Y1|GATA_PROM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL1A) GN=gatA PE=3 SV=1 40 536 5.0E-37
sp|Q2RPH4|GATA_RHORT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatA PE=3 SV=1 36 530 6.0E-37
sp|Q46L72|GATA_PROMT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL2A) GN=gatA PE=3 SV=1 40 536 6.0E-37
sp|Q5N0K5|GATA_SYNP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatA PE=3 SV=1 39 539 9.0E-37
sp|Q0AZZ2|GATA_SYNWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gatA PE=3 SV=1 35 530 9.0E-37
sp|B1I3K2|GATA_DESAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulforudis audaxviator (strain MP104C) GN=gatA PE=3 SV=1 36 536 1.0E-36
sp|A7IMA7|GATA_XANP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatA PE=3 SV=1 36 529 2.0E-36
sp|Q5L3B3|GATA_GEOKA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus kaustophilus (strain HTA426) GN=gatA PE=3 SV=1 36 530 2.0E-36
sp|Q9HVT8|GATA_PSEAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatA PE=1 SV=1 36 356 2.0E-36
sp|Q31LC2|GATA_SYNE7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus elongatus (strain PCC 7942) GN=gatA PE=3 SV=1 39 539 2.0E-36
sp|Q6AQK1|GATA_DESPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatA PE=3 SV=1 37 528 3.0E-36
sp|Q02GV8|GATA_PSEAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatA PE=3 SV=1 36 356 3.0E-36
sp|B7V023|GATA_PSEA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain LESB58) GN=gatA PE=3 SV=1 36 356 3.0E-36
sp|Q9RTA9|GATA_DEIRA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatA PE=3 SV=1 43 358 3.0E-36
sp|Q8R679|GATA_FUSNN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatA PE=3 SV=1 32 345 3.0E-36
sp|Q9Z580|GATA_STRCO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gatA PE=3 SV=1 35 529 4.0E-36
sp|Q7NKF0|GATA_GLOVI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gloeobacter violaceus (strain PCC 7421) GN=gatA PE=3 SV=1 40 531 4.0E-36
sp|Q8ES78|GATA_OCEIH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gatA PE=3 SV=1 36 536 5.0E-36
sp|Q113L8|GATA_TRIEI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Trichodesmium erythraeum (strain IMS101) GN=gatA PE=3 SV=1 39 343 5.0E-36
sp|Q3Z6V3|GATA_DEHM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatA PE=3 SV=1 35 530 5.0E-36
sp|C0QRF9|GATA_PERMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatA PE=3 SV=1 35 344 6.0E-36
sp|A7NKM0|GATA_ROSCS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gatA PE=3 SV=1 36 530 7.0E-36
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 44 342 8.0E-36
sp|B2GDS6|GATA_LACF3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gatA PE=3 SV=1 36 530 8.0E-36
sp|Q6MRL7|GATA_BDEBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatA PE=3 SV=1 35 530 9.0E-36
sp|Q03EG5|GATA_PEDPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gatA PE=3 SV=1 36 531 1.0E-35
sp|Q8PXJ1|GATA_METMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatA PE=3 SV=1 71 536 1.0E-35
sp|B9DWL8|GATA_CLOK1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium kluyveri (strain NBRC 12016) GN=gatA PE=3 SV=1 57 531 2.0E-35
sp|Q1LSE1|GATA_CUPMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gatA PE=3 SV=1 40 538 2.0E-35
sp|B8D125|GATA_HALOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gatA PE=3 SV=1 35 536 2.0E-35
sp|Q82JL0|GATA_STRAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gatA PE=3 SV=1 30 529 2.0E-35
sp|A4J6Z8|GATA_DESRM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotomaculum reducens (strain MI-1) GN=gatA PE=3 SV=1 35 534 2.0E-35
sp|B8J405|GATA_DESDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gatA PE=3 SV=1 35 529 2.0E-35
sp|Q93LE2|GATA_GEOSE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus stearothermophilus GN=gatA PE=3 SV=1 36 530 2.0E-35
sp|Q4ZNS7|GATA_PSEU2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatA PE=3 SV=1 36 530 2.0E-35
sp|Q0I9N6|GATA_SYNS3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9311) GN=gatA PE=3 SV=1 40 537 2.0E-35
sp|A6VBJ8|GATA_PSEA7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain PA7) GN=gatA PE=3 SV=1 36 356 2.0E-35
sp|Q48E92|GATA_PSE14 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatA PE=3 SV=1 36 530 3.0E-35
sp|Q9JTZ5|GATA_NEIMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatA PE=3 SV=1 48 521 3.0E-35
sp|Q87WR9|GATA_PSESM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatA PE=3 SV=1 36 530 3.0E-35
sp|Q2G4F5|GATA_NOVAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatA PE=3 SV=1 35 537 3.0E-35
sp|B0C269|GATA_ACAM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acaryochloris marina (strain MBIC 11017) GN=gatA PE=3 SV=1 39 531 3.0E-35
sp|Q0ACB5|GATA_ALKEH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatA PE=3 SV=1 36 530 3.0E-35
sp|B3DWT4|GATA_METI4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylacidiphilum infernorum (isolate V4) GN=gatA PE=3 SV=1 36 530 4.0E-35
sp|C1DQ37|GATA_AZOVD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatA PE=3 SV=1 36 530 4.0E-35
sp|A1K1T5|GATA_AZOSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azoarcus sp. (strain BH72) GN=gatA PE=3 SV=1 36 536 4.0E-35
sp|A4IJZ2|GATA_GEOTN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatA PE=3 SV=1 36 530 6.0E-35
sp|A8FAS0|GATA_BACP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus pumilus (strain SAFR-032) GN=gatA PE=3 SV=1 36 536 6.0E-35
sp|Q3AKH0|GATA_SYNSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9605) GN=gatA PE=3 SV=1 35 536 7.0E-35
sp|B1YM01|GATA_EXIS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gatA PE=3 SV=1 36 530 7.0E-35
sp|A1U486|GATA_MARHV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gatA PE=3 SV=1 36 530 7.0E-35
sp|A0Q2Q0|GATA_CLONN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium novyi (strain NT) GN=gatA PE=3 SV=1 35 530 7.0E-35
sp|B7GFW3|GATA_ANOFW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gatA PE=3 SV=1 36 530 8.0E-35
sp|B4S4W1|GATA_PROA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gatA PE=3 SV=1 39 531 8.0E-35
sp|Q2SBG5|GATA_HAHCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hahella chejuensis (strain KCTC 2396) GN=gatA PE=3 SV=1 40 530 8.0E-35
sp|C3K6Y4|GATA_PSEFS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain SBW25) GN=gatA PE=3 SV=1 36 356 9.0E-35
sp|A4SGD2|GATA_CHLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gatA PE=3 SV=1 39 490 1.0E-34
sp|B7K0I2|GATA_CYAP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 8801) GN=gatA PE=3 SV=1 39 531 2.0E-34
sp|A0LSR0|GATA_ACIC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gatA PE=3 SV=1 35 541 2.0E-34
sp|Q0AFP4|GATA_NITEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas eutropha (strain C91) GN=gatA PE=3 SV=1 54 345 2.0E-34
sp|C4ZHB9|GATA_EUBR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatA PE=3 SV=1 35 538 2.0E-34
sp|Q2JUM6|GATA_SYNJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatA PE=3 SV=1 57 530 3.0E-34
sp|Q2JL51|GATA_SYNJB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatA PE=3 SV=1 57 530 4.0E-34
sp|Q1IUE4|GATA_KORVE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Koribacter versatilis (strain Ellin345) GN=gatA PE=3 SV=1 86 529 4.0E-34
sp|A4X490|GATA_SALTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gatA PE=3 SV=1 35 490 5.0E-34
sp|C5D4K6|GATA_GEOSW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus sp. (strain WCH70) GN=gatA PE=3 SV=1 36 530 7.0E-34
sp|P63489|GATA_STAAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain N315) GN=gatA PE=1 SV=1 37 527 7.0E-34
sp|P63488|GATA_STAAM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatA PE=1 SV=1 37 527 7.0E-34
sp|A7X427|GATA_STAA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatA PE=3 SV=1 37 527 7.0E-34
sp|Q8UFS8|GATA_AGRFC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatA PE=3 SV=2 35 529 7.0E-34
sp|A1KUH8|GATA_NEIMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gatA PE=3 SV=1 48 345 9.0E-34
sp|Q46E35|GATA_METBF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatA PE=3 SV=1 80 536 9.0E-34
sp|Q8NVT3|GATA_STAAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MW2) GN=gatA PE=3 SV=1 37 527 1.0E-33
sp|Q6G833|GATA_STAAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MSSA476) GN=gatA PE=3 SV=1 37 527 1.0E-33
sp|A5IU67|GATA_STAA9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH9) GN=gatA PE=3 SV=1 37 527 1.0E-33
sp|A6U305|GATA_STAA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH1) GN=gatA PE=3 SV=1 37 527 1.0E-33
sp|Q0VS72|GATA_ALCBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatA PE=3 SV=1 36 530 1.0E-33
sp|Q9Z9W9|GATA_BACHD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatA PE=3 SV=1 36 536 1.0E-33
sp|Q5F8U8|GATA_NEIG1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatA PE=3 SV=1 48 345 1.0E-33
sp|Q12VH1|GATA_METBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatA PE=3 SV=1 40 536 1.0E-33
sp|Q3J7V7|GATA_NITOC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatA PE=3 SV=1 36 530 2.0E-33
sp|Q313S5|GATA_DESAG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio alaskensis (strain G20) GN=gatA PE=3 SV=1 36 528 2.0E-33
sp|Q7UT33|GATA_RHOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gatA PE=3 SV=1 40 345 2.0E-33
sp|Q9RF07|GATA_STAAU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus GN=gatA PE=3 SV=1 37 527 2.0E-33
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 40 350 2.0E-33
sp|Q6GFF7|GATA_STAAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MRSA252) GN=gatA PE=3 SV=1 37 527 2.0E-33
sp|B3EM22|GATA_CHLPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium phaeobacteroides (strain BS1) GN=gatA PE=3 SV=1 36 358 2.0E-33
sp|B2G8T6|GATA_LACRJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain JCM 1112) GN=gatA PE=3 SV=1 35 530 3.0E-33
sp|A5VLG3|GATA_LACRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain DSM 20016) GN=gatA PE=3 SV=1 35 530 3.0E-33
sp|O66610|GATA_AQUAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aquifex aeolicus (strain VF5) GN=gatA PE=1 SV=1 36 531 3.0E-33
sp|B2T1M4|GATA_BURPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatA PE=3 SV=1 36 353 3.0E-33
sp|A8Z2R4|GATA_STAAT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|A6QIC8|GATA_STAAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Newman) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|Q5HEM2|GATA_STAAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain COL) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|Q2FWY9|GATA_STAA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|Q2FFJ5|GATA_STAA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|Q65MP8|GATA_BACLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatA PE=3 SV=1 36 536 3.0E-33
sp|A1AW13|GATA_RUTMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatA PE=3 SV=1 36 339 3.0E-33
sp|Q49YU4|GATA_STAS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gatA PE=3 SV=1 37 527 3.0E-33
sp|B2IYD7|GATA_NOSP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatA PE=3 SV=1 39 536 4.0E-33
sp|B8GL95|GATA_THISH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatA PE=3 SV=1 36 530 5.0E-33
sp|A9M003|GATA_NEIM0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C (strain 053442) GN=gatA PE=3 SV=1 48 521 5.0E-33
sp|Q6MDF5|GATA_PARUW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Protochlamydia amoebophila (strain UWE25) GN=gatA PE=3 SV=1 36 345 6.0E-33
sp|Q2YU51|GATA_STAAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gatA PE=3 SV=1 37 527 6.0E-33
sp|Q4L7L4|GATA_STAHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatA PE=3 SV=1 37 527 7.0E-33
sp|Q3M6N4|GATA_ANAVT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatA PE=3 SV=1 39 536 7.0E-33
sp|B4RM85|GATA_NEIG2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatA PE=3 SV=1 48 345 9.0E-33
sp|Q03AC0|GATA_LACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain ATCC 334) GN=gatA PE=3 SV=1 35 527 9.0E-33
sp|Q5NPF3|GATA_ZYMMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatA PE=3 SV=1 36 528 9.0E-33
sp|Q5HN34|GATA_STAEQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatA PE=3 SV=1 40 527 1.0E-32
sp|Q9JYZ9|GATA_NEIMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatA PE=3 SV=1 48 521 1.0E-32
sp|Q8THJ1|GATA_METAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatA PE=3 SV=1 57 536 1.0E-32
sp|Q2YC91|GATA_NITMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatA PE=3 SV=2 36 345 1.0E-32
sp|B3WD57|GATA_LACCB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain BL23) GN=gatA PE=3 SV=1 35 527 1.0E-32
sp|A1UT20|GATA_BARBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gatA PE=3 SV=1 35 540 2.0E-32
sp|Q837V3|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatA PE=3 SV=1 36 530 2.0E-32
sp|Q7VCJ0|GATA_PROMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatA PE=3 SV=1 40 531 2.0E-32
sp|A9KJ26|GATA_CLOPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatA PE=3 SV=1 43 537 2.0E-32
sp|Q7U7F4|GATA_SYNPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH8102) GN=gatA PE=3 SV=1 40 529 2.0E-32
sp|A5CX65|GATA_VESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatA PE=3 SV=1 36 534 3.0E-32
sp|B3QYQ7|GATA_CHLT3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatA PE=3 SV=1 40 490 3.0E-32
sp|Q47JV4|GATA_DECAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dechloromonas aromatica (strain RCB) GN=gatA PE=3 SV=1 36 536 3.0E-32
sp|A8M5E6|GATA_SALAI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora arenicola (strain CNS-205) GN=gatA PE=3 SV=1 35 529 4.0E-32
sp|Q8CRU3|GATA_STAES Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatA PE=3 SV=1 40 527 4.0E-32
sp|C0R074|GATA_BRAHW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatA PE=3 SV=1 35 531 4.0E-32
sp|Q2T293|GATA_BURTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatA PE=3 SV=1 36 353 5.0E-32
sp|A5GKM7|GATA_SYNPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH7803) GN=gatA PE=3 SV=1 40 533 5.0E-32
sp|Q146Y5|GATA_BURXL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia xenovorans (strain LB400) GN=gatA PE=3 SV=1 36 353 6.0E-32
sp|B1MDU8|GATA_MYCA9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=gatA PE=3 SV=1 35 543 6.0E-32
sp|B9DMT8|GATA_STACT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus carnosus (strain TM300) GN=gatA PE=3 SV=1 37 528 6.0E-32
sp|Q8YY02|GATA_NOSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatA PE=3 SV=1 39 536 7.0E-32
sp|B8EPC1|GATA_METSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatA PE=3 SV=1 36 345 8.0E-32
sp|O69768|AMID_PSEPU Amidase OS=Pseudomonas putida PE=3 SV=1 36 530 8.0E-32
sp|C6BSE9|GATA_DESAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gatA PE=3 SV=1 36 528 8.0E-32
sp|C4Z3J4|GATA_EUBE2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatA PE=3 SV=1 36 529 8.0E-32
sp|B2UZ26|GATA_CLOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatA PE=3 SV=1 35 531 1.0E-31
sp|A2BQY7|GATA_PROMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain AS9601) GN=gatA PE=3 SV=1 57 490 1.0E-31
sp|Q0VFI5|GATA_XENTR Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus tropicalis GN=qrsl1 PE=2 SV=1 40 345 1.0E-31
sp|B2TIZ9|GATA_CLOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatA PE=3 SV=1 38 531 1.0E-31
sp|P9WQ93|AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amiD PE=1 SV=1 26 530 2.0E-31
sp|P9WQ92|AMI4_MYCTO Putative amidase AmiD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amiD PE=3 SV=1 26 530 2.0E-31
sp|P63497|AMI4_MYCBO Putative amidase AmiD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amiD PE=3 SV=1 26 530 2.0E-31
sp|Q04DD1|GATA_OENOB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gatA PE=3 SV=1 86 531 2.0E-31
sp|A8ZSP8|GATA_DESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gatA PE=3 SV=1 37 353 3.0E-31
sp|A0L5G0|GATA_MAGMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gatA PE=3 SV=1 36 530 3.0E-31
sp|C0QKZ5|GATA_DESAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=gatA PE=3 SV=1 35 345 4.0E-31
sp|Q820J1|GATA_NITEU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatA PE=3 SV=1 54 530 5.0E-31
sp|A2CA16|GATA_PROM3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9303) GN=gatA PE=3 SV=1 40 529 5.0E-31
sp|Q8G768|GATA_BIFLO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain NCC 2705) GN=gatA PE=3 SV=1 36 490 6.0E-31
sp|B3DU32|GATA_BIFLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain DJO10A) GN=gatA PE=3 SV=1 36 490 6.0E-31
sp|A1WVR7|GATA_HALHL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatA PE=3 SV=1 36 530 6.0E-31
sp|C0ME97|GATA_STRS7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatA PE=3 SV=1 40 530 6.0E-31
sp|Q1WSH9|GATA_LACS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus salivarius (strain UCC118) GN=gatA PE=3 SV=1 35 544 7.0E-31
sp|A9AC51|GATA_BURM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gatA PE=3 SV=1 36 353 7.0E-31
sp|Q38VC9|GATA_LACSS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gatA PE=3 SV=1 35 531 7.0E-31
sp|B2A5W7|GATA_NATTJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gatA PE=3 SV=1 36 334 8.0E-31
sp|Q5FND3|GATA_GLUOX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gluconobacter oxydans (strain 621H) GN=gatA PE=3 SV=1 36 529 9.0E-31
sp|Q6FZS9|GATA_BARQU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella quintana (strain Toulouse) GN=gatA PE=3 SV=1 35 345 1.0E-30
sp|Q2K939|GATA_RHIEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatA PE=3 SV=1 35 529 1.0E-30
sp|B4U197|GATA_STREM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gatA PE=3 SV=1 40 530 1.0E-30
sp|A4XQK6|GATA_PSEMY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas mendocina (strain ymp) GN=gatA PE=3 SV=1 36 356 1.0E-30
sp|Q8Y6D2|GATA_LISMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gatA PE=3 SV=1 36 530 1.0E-30
sp|B0KQG0|GATA_PSEPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain GB-1) GN=gatA PE=3 SV=1 36 356 1.0E-30
sp|C1KW54|GATA_LISMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gatA PE=3 SV=1 36 530 1.0E-30
sp|C0M7E8|GATA_STRE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. equi (strain 4047) GN=gatA PE=3 SV=1 40 530 1.0E-30
sp|A7Z267|GATA_BACMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatA PE=3 SV=1 36 536 2.0E-30
sp|Q71YR3|GATA_LISMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gatA PE=3 SV=1 36 530 2.0E-30
sp|Q83BM9|GATA_COXBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatA PE=3 SV=1 36 345 2.0E-30
sp|A9N8Z4|GATA_COXBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatA PE=3 SV=1 36 345 2.0E-30
sp|A9KBI0|GATA_COXBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatA PE=3 SV=1 36 345 2.0E-30
sp|B6IZ25|GATA_COXB2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuG_Q212) GN=gatA PE=3 SV=1 36 345 2.0E-30
sp|B6J4H5|GATA_COXB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuK_Q154) GN=gatA PE=3 SV=1 36 345 2.0E-30
sp|Q98M95|GATA_RHILO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium loti (strain MAFF303099) GN=gatA PE=3 SV=1 35 345 2.0E-30
sp|A0AJK8|GATA_LISW6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gatA PE=3 SV=1 36 530 2.0E-30
sp|Q7V7T6|GATA_PROMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9313) GN=gatA PE=3 SV=1 40 529 2.0E-30
sp|B4E7X6|GATA_BURCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gatA PE=3 SV=1 36 353 2.0E-30
sp|Q1QVB5|GATA_CHRSD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gatA PE=3 SV=1 36 539 2.0E-30
sp|A0KBH9|GATA_BURCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain HI2424) GN=gatA PE=3 SV=1 36 353 2.0E-30
sp|B1K0H7|GATA_BURCC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain MC0-3) GN=gatA PE=3 SV=1 36 353 2.0E-30
sp|Q1BSL2|GATA_BURCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain AU 1054) GN=gatA PE=3 SV=1 36 353 2.0E-30
sp|A5WCI2|GATA_PSYWF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter sp. (strain PRwf-1) GN=gatA PE=3 SV=1 35 530 2.0E-30
sp|A5VZ22|GATA_PSEP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gatA PE=3 SV=1 36 356 3.0E-30
sp|B9DVG6|GATA_STRU0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatA PE=3 SV=1 36 343 3.0E-30
sp|B1YPV8|GATA_BURA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia ambifaria (strain MC40-6) GN=gatA PE=3 SV=1 36 353 3.0E-30
sp|Q92AQ3|GATA_LISIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gatA PE=3 SV=1 36 530 3.0E-30
sp|A2BWS5|GATA_PROM5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9515) GN=gatA PE=3 SV=1 44 528 3.0E-30
sp|A4WUQ2|GATA_RHOS5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatA PE=3 SV=1 38 529 3.0E-30
sp|B8DFG8|GATA_LISMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gatA PE=3 SV=1 36 530 3.0E-30
sp|Q47SC3|GATA_THEFY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermobifida fusca (strain YX) GN=gatA PE=3 SV=1 35 490 4.0E-30
sp|A6U819|GATA_SINMW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sinorhizobium medicae (strain WSM419) GN=gatA PE=3 SV=1 35 529 4.0E-30
sp|B1JDP1|GATA_PSEPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain W619) GN=gatA PE=3 SV=1 36 356 4.0E-30
sp|B4SCS6|GATA_PELPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gatA PE=3 SV=1 39 490 4.0E-30
sp|B6U151|GATA_MAIZE Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Zea mays GN=GATA PE=2 SV=1 39 531 5.0E-30
sp|Q7NPY7|GATA_CHRVO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gatA PE=3 SV=1 36 530 5.0E-30
sp|Q0BAV4|GATA_BURCM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gatA PE=3 SV=1 36 353 5.0E-30
sp|A9W748|GATA_METEP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain PA1) GN=gatA PE=3 SV=1 36 343 6.0E-30
sp|C0Z4E4|GATA_BREBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gatA PE=3 SV=1 36 528 6.0E-30
sp|A3PCR0|GATA_PROM0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9301) GN=gatA PE=3 SV=1 57 490 6.0E-30
sp|B2IEA4|GATA_BEII9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatA PE=3 SV=1 35 345 6.0E-30
sp|Q9X0Z9|GATA_THEMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gatA PE=1 SV=1 95 490 6.0E-30
sp|B5YL59|GATA_THEYD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatA PE=3 SV=1 35 530 6.0E-30
sp|B8I601|GATA_CLOCE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatA PE=3 SV=1 35 343 7.0E-30
sp|Q1MHJ5|GATA_RHIL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatA PE=3 SV=1 35 529 8.0E-30
sp|B7GTU6|GATA_BIFLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gatA PE=3 SV=1 36 490 8.0E-30
sp|Q63GR0|GATA_BACCZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ZK / E33L) GN=gatA PE=3 SV=1 36 530 8.0E-30
sp|Q39BW3|GATA_BURL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gatA PE=3 SV=1 36 353 8.0E-30
sp|O06491|GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) GN=gatA PE=3 SV=3 36 536 8.0E-30
sp|B7HSY0|GATA_BACC7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH187) GN=gatA PE=3 SV=1 36 530 9.0E-30
sp|Q73EK8|GATA_BACC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatA PE=3 SV=1 36 530 9.0E-30
sp|B1GZD3|GATA_UNCTG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatA PE=3 SV=1 35 356 9.0E-30
sp|C3MAA3|GATA_RHISN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium sp. (strain NGR234) GN=gatA PE=3 SV=1 35 529 9.0E-30
sp|A9WPN2|GATA_RENSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=gatA PE=3 SV=1 51 345 9.0E-30
sp|B9J1N0|GATA_BACCQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain Q1) GN=gatA PE=3 SV=1 36 530 9.0E-30
sp|B7JMB2|GATA_BACC0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH820) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|Q81ZE8|GATA_BACAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|C3L559|GATA_BACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|C3PBQ4|GATA_BACAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain A0248) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|B7H4W2|GATA_BACC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain B4264) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|B7IUX9|GATA_BACC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain G9842) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|Q6HP81|GATA_BACHK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|C1EV88|GATA_BACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain 03BB102) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|A0R921|GATA_BACAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|A6VWN0|GATA_MARMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinomonas sp. (strain MWYL1) GN=gatA PE=3 SV=1 36 534 1.0E-29
sp|Q5P4D0|GATA_AROAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aromatoleum aromaticum (strain EbN1) GN=gatA PE=3 SV=1 36 539 1.0E-29
sp|A1V776|GATA_BURMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia mallei (strain SAVP1) GN=gatA PE=3 SV=1 36 353 1.0E-29
sp|Q62MR4|GATA_BURMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia mallei (strain ATCC 23344) GN=gatA PE=3 SV=1 36 353 1.0E-29
sp|A2S8I9|GATA_BURM9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia mallei (strain NCTC 10229) GN=gatA PE=3 SV=1 36 353 1.0E-29
sp|A3MNR6|GATA_BURM7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia mallei (strain NCTC 10247) GN=gatA PE=3 SV=1 36 353 1.0E-29
sp|A9VRH7|GATA_BACWK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|Q6A8P5|GATA_PROAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gatA PE=3 SV=1 35 345 1.0E-29
sp|B6IN23|GATA_RHOCS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gatA PE=3 SV=1 36 529 1.0E-29
sp|Q81IN3|GATA_BACCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|A4JIT0|GATA_BURVG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gatA PE=3 SV=1 36 353 1.0E-29
sp|Q5WJ20|GATA_BACSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus clausii (strain KSM-K16) GN=gatA PE=3 SV=1 36 530 1.0E-29
sp|Q88PB9|GATA_PSEPK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain KT2440) GN=gatA PE=3 SV=1 36 356 2.0E-29
sp|Q2W6Y6|GATA_MAGSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatA PE=3 SV=2 36 345 2.0E-29
sp|Q63YJ9|GATA_BURPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain K96243) GN=gatA PE=3 SV=1 36 353 2.0E-29
sp|A3N4F4|GATA_BURP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 668) GN=gatA PE=3 SV=1 36 353 2.0E-29
sp|Q3JXC1|GATA_BURP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 1710b) GN=gatA PE=3 SV=1 36 353 2.0E-29
sp|A3NQ45|GATA_BURP0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 1106a) GN=gatA PE=3 SV=1 36 353 2.0E-29
sp|Q1MPY8|GATA_LAWIP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatA PE=3 SV=1 64 345 3.0E-29
sp|B9E826|GATA_MACCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Macrococcus caseolyticus (strain JCSC5402) GN=gatA PE=3 SV=1 37 528 3.0E-29
sp|Q8YC57|GATA_BRUME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatA PE=3 SV=2 35 345 3.0E-29
sp|P9WQA1|GATA_MYCTU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gatA PE=1 SV=1 106 529 3.0E-29
sp|P9WQA0|GATA_MYCTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gatA PE=3 SV=1 106 529 3.0E-29
sp|A5U723|GATA_MYCTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gatA PE=3 SV=1 106 529 3.0E-29
sp|C1AGC7|GATA_MYCBT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=gatA PE=3 SV=1 106 529 3.0E-29
sp|A1KN06|GATA_MYCBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gatA PE=3 SV=1 106 529 3.0E-29
sp|Q7TXG2|GATA_MYCBO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gatA PE=3 SV=1 106 529 3.0E-29
sp|C0RLB5|GATA_BRUMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatA PE=3 SV=1 35 345 3.0E-29
sp|A9MBN4|GATA_BRUC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatA PE=3 SV=1 35 345 3.0E-29
sp|Q74I52|GATA_LACJO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatA PE=3 SV=1 40 356 3.0E-29
sp|Q8FW67|GATA_BRUSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis biovar 1 (strain 1330) GN=gatA PE=3 SV=1 35 345 3.0E-29
sp|Q72L58|GATA_THET2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gatA PE=3 SV=1 42 345 4.0E-29
sp|Q1GUW3|GATA_SPHAL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gatA PE=3 SV=1 35 528 4.0E-29
sp|Q92QK7|GATA_RHIME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium meliloti (strain 1021) GN=gatA PE=3 SV=1 35 529 4.0E-29
sp|A5VUS6|GATA_BRUO2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatA PE=3 SV=1 35 345 4.0E-29
sp|Q58560|GATA_METJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatA PE=3 SV=1 56 345 4.0E-29
sp|B7KWB0|GATA_METC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatA PE=3 SV=1 36 343 4.0E-29
sp|Q9A5L0|GATA_CAUCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatA PE=3 SV=1 46 345 5.0E-29
sp|B8GZJ5|GATA_CAUCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gatA PE=3 SV=1 46 345 5.0E-29
sp|Q9LCX3|GATA_THET8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gatA PE=1 SV=2 43 490 5.0E-29
sp|A9WYR3|GATA_BRUSI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatA PE=3 SV=1 35 345 7.0E-29
sp|A7GKK3|GATA_BACCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatA PE=3 SV=1 36 530 7.0E-29
sp|A6X562|GATA_OCHA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatA PE=3 SV=1 35 345 7.0E-29
sp|Q1IED3|GATA_PSEE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas entomophila (strain L48) GN=gatA PE=3 SV=1 36 358 7.0E-29
sp|A8G4M8|GATA_PROM2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9215) GN=gatA PE=3 SV=1 57 490 9.0E-29
sp|Q8AVG9|GATA_XENLA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus laevis GN=qrsl1 PE=2 SV=1 40 345 1.0E-28
sp|Q3SM39|GATA_THIDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatA PE=3 SV=1 54 530 1.0E-28
sp|Q3ATD7|GATA_CHLCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium chlorochromatii (strain CaD3) GN=gatA PE=3 SV=1 39 345 1.0E-28
sp|Q577Z3|GATA_BRUAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus biovar 1 (strain 9-941) GN=gatA PE=3 SV=1 35 345 1.0E-28
sp|Q2YKL3|GATA_BRUA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain 2308) GN=gatA PE=3 SV=1 35 345 1.0E-28
sp|B2SB62|GATA_BRUA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain S19) GN=gatA PE=3 SV=1 35 345 1.0E-28
sp|Q5V2G6|GATA_HALMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gatA PE=3 SV=1 104 356 2.0E-28
sp|B1ZLM1|GATA_METPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatA PE=3 SV=1 36 343 2.0E-28
sp|B5ZMJ0|GATA_RHILW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatA PE=3 SV=1 35 529 2.0E-28
sp|B2U7V7|GATA_RALPJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia pickettii (strain 12J) GN=gatA PE=3 SV=1 39 530 2.0E-28
sp|A3CLF8|GATA_STRSV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus sanguinis (strain SK36) GN=gatA PE=3 SV=1 40 530 2.0E-28
sp|B2UMP4|GATA_AKKM8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gatA PE=3 SV=1 106 358 2.0E-28
sp|Q31B32|GATA_PROM9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9312) GN=gatA PE=3 SV=1 57 534 2.0E-28
sp|O27955|GATA_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatA PE=3 SV=1 86 523 3.0E-28
sp|Q25A68|GATA_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATA PE=3 SV=1 39 531 3.0E-28
sp|Q8KFQ4|GATA_CHLTE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gatA PE=3 SV=1 42 332 3.0E-28
sp|Q6NHQ1|GATA_CORDI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gatA PE=3 SV=1 36 531 3.0E-28
sp|Q7QH64|GATA_ANOGA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Anopheles gambiae GN=gatA PE=3 SV=3 86 343 3.0E-28
sp|Q7X8Z8|GATA_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATA PE=3 SV=3 39 531 3.0E-28
sp|Q72DX1|GATA_DESVH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gatA PE=3 SV=1 106 529 3.0E-28
sp|A9IU58|GATA_BART1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gatA PE=3 SV=1 35 345 4.0E-28
sp|Q2S4S2|GATA_SALRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatA PE=3 SV=1 45 353 4.0E-28
sp|C5Y8Z8|GATA_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATA PE=3 SV=1 39 531 4.0E-28
sp|B2JJW2|GATA_BURP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gatA PE=3 SV=1 36 353 4.0E-28
sp|Q5YRT4|GATA_NOCFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nocardia farcinica (strain IFM 10152) GN=gatA PE=3 SV=1 35 529 4.0E-28
sp|Q5FLL1|GATA_LACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatA PE=3 SV=1 40 353 5.0E-28
sp|A1VFG9|GATA_DESVV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gatA PE=3 SV=1 106 529 5.0E-28
sp|B6JFW2|GATA_OLICO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gatA PE=3 SV=1 35 345 5.0E-28
sp|Q041K5|GATA_LACGA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatA PE=3 SV=1 40 356 5.0E-28
sp|Q3AVK4|GATA_SYNS9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9902) GN=gatA PE=3 SV=1 35 540 5.0E-28
sp|Q5LP80|GATA_RUEPO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatA PE=3 SV=1 35 529 5.0E-28
sp|A5EY31|GATA_DICNV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dichelobacter nodosus (strain VCS1703A) GN=gatA PE=3 SV=1 35 530 6.0E-28
sp|C0ZXK7|GATA_RHOE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=gatA PE=3 SV=1 35 529 6.0E-28
sp|B4R968|GATA_PHEZH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Phenylobacterium zucineum (strain HLK1) GN=gatA PE=3 SV=1 46 529 6.0E-28
sp|Q2GEE7|GATA_NEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neorickettsia sennetsu (strain Miyayama) GN=gatA PE=3 SV=1 35 490 7.0E-28
sp|Q971U6|GATA_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatA PE=3 SV=2 57 353 8.0E-28
sp|A5EKP4|GATA_BRASB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatA PE=3 SV=1 35 529 8.0E-28
sp|A8AVE2|GATA_STRGC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatA PE=3 SV=1 106 530 8.0E-28
sp|Q9H0R6|GATA_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Homo sapiens GN=QRSL1 PE=1 SV=2 40 345 1.0E-27
sp|Q0KFF8|GATA_CUPNH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gatA PE=3 SV=1 40 536 1.0E-27
sp|Q168I9|GATA_ROSDO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gatA PE=3 SV=1 36 529 2.0E-27
sp|Q3ISR6|GATA_NATPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gatA PE=3 SV=1 87 356 2.0E-27
sp|B0WAE3|GATA_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Culex quinquefasciatus GN=gatA PE=3 SV=1 39 344 2.0E-27
sp|Q5NIP6|GATA_FRATT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gatA PE=3 SV=1 41 490 2.0E-27
sp|Q14K49|GATA_FRAT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gatA PE=3 SV=1 41 490 2.0E-27
sp|A4TE06|GATA_MYCGI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium gilvum (strain PYR-GCK) GN=gatA PE=3 SV=1 86 529 2.0E-27
sp|Q5X4H5|GATA_LEGPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Paris) GN=gatA PE=3 SV=1 40 535 3.0E-27
sp|Q07L94|GATA_RHOP5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisA53) GN=gatA PE=3 SV=1 35 345 3.0E-27
sp|Q3B228|GATA_CHLL7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gatA PE=3 SV=1 39 534 3.0E-27
sp|A6SUD7|GATA_JANMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Janthinobacterium sp. (strain Marseille) GN=gatA PE=3 SV=1 36 538 4.0E-27
sp|A8YTZ6|GATA_LACH4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=gatA PE=3 SV=1 40 356 4.0E-27
sp|A4IVY3|GATA_FRATW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gatA PE=3 SV=1 41 490 4.0E-27
sp|A8F5H6|GATA_PSELT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatA PE=3 SV=1 104 343 4.0E-27
sp|Q8FPZ0|GATA_COREF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gatA PE=3 SV=1 31 531 5.0E-27
sp|B2SEM6|GATA_FRATM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gatA PE=3 SV=1 41 490 5.0E-27
sp|Q73HP2|GATA_WOLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis wMel GN=gatA PE=3 SV=1 35 489 5.0E-27
sp|Q6G3E9|GATA_BARHE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gatA PE=3 SV=1 35 529 6.0E-27
sp|A2RHP5|GATA_LACLM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gatA PE=3 SV=1 40 530 6.0E-27
sp|C4K0R4|GATA_RICPU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia peacockii (strain Rustic) GN=gatA PE=3 SV=1 35 531 7.0E-27
sp|Q1GFB5|GATA_RUEST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria sp. (strain TM1040) GN=gatA PE=3 SV=1 35 529 8.0E-27
sp|Q1RHE9|GATA_RICBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain RML369-C) GN=gatA PE=3 SV=1 35 531 8.0E-27
sp|Q8Y3C3|GATA_RALSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia solanacearum (strain GMI1000) GN=gatA PE=3 SV=1 39 538 8.0E-27
sp|Q92J75|GATA_RICCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatA PE=3 SV=1 35 531 9.0E-27
sp|Q4R7R9|GATA_MACFA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Macaca fascicularis GN=QRSL1 PE=2 SV=1 40 345 9.0E-27
sp|B9KPF8|GATA_RHOSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatA PE=3 SV=1 38 529 9.0E-27
sp|B3CQQ9|GATA_ORITI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Ikeda) GN=gatA PE=3 SV=1 35 539 9.0E-27
sp|Q4JUM4|GATA_CORJK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium jeikeium (strain K411) GN=gatA PE=3 SV=1 35 527 1.0E-26
sp|B9JVJ1|GATA_AGRVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatA PE=3 SV=1 35 529 1.0E-26
sp|Q032T3|GATA_LACLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gatA PE=3 SV=1 40 530 1.0E-26
sp|E2QUD0|GATA_CANLF Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Canis lupus familiaris GN=QRSL1 PE=3 SV=1 40 345 1.0E-26
sp|Q5WVW0|GATA_LEGPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Lens) GN=gatA PE=3 SV=1 40 535 1.0E-26
sp|Q9CJ43|GATA_LACLA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gatA PE=3 SV=1 40 530 1.0E-26
sp|Q17H91|GATA_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Aedes aegypti GN=gatA PE=3 SV=1 76 350 1.0E-26
sp|A0RU64|GATA_CENSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cenarchaeum symbiosum (strain A) GN=gatA PE=3 SV=1 72 341 1.0E-26
sp|Q68XL6|GATA_RICTY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatA PE=3 SV=1 35 531 1.0E-26
sp|Q89K29|GATA_BRADU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatA PE=3 SV=1 35 315 1.0E-26
sp|A8GV46|GATA_RICB8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain OSU 85-389) GN=gatA PE=3 SV=1 35 490 1.0E-26
sp|F7A3P2|GATA_ORNAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ornithorhynchus anatinus GN=QRSL1 PE=3 SV=1 40 345 1.0E-26
sp|Q9LI77|GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATA PE=2 SV=1 38 531 1.0E-26
sp|Q1QL30|GATA_NITHX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gatA PE=3 SV=1 35 315 2.0E-26
sp|A0Q8I2|GATA_FRATN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. novicida (strain U112) GN=gatA PE=3 SV=1 41 490 2.0E-26
sp|Q0BK40|GATA_FRATO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gatA PE=3 SV=1 41 490 2.0E-26
sp|Q2A1D8|GATA_FRATH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gatA PE=3 SV=1 41 490 2.0E-26
sp|A7NEM1|GATA_FRATF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gatA PE=3 SV=1 41 490 2.0E-26
sp|Q04BV7|GATA_LACDB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatA PE=3 SV=1 40 356 2.0E-26
sp|Q11IL4|GATA_CHESB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chelativorans sp. (strain BNC1) GN=gatA PE=3 SV=1 35 345 2.0E-26
sp|Q2J6U6|GATA_FRASC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Frankia sp. (strain CcI3) GN=gatA PE=3 SV=1 51 529 2.0E-26
sp|Q2FQM9|GATA_METHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gatA PE=3 SV=1 104 528 3.0E-26
sp|A1T6Y0|GATA_MYCVP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=gatA PE=3 SV=1 95 529 3.0E-26
sp|Q1GBF4|GATA_LACDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatA PE=3 SV=1 40 356 3.0E-26
sp|B0T193|GATA_CAUSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter sp. (strain K31) GN=gatA PE=3 SV=1 46 311 3.0E-26
sp|A8GMC0|GATA_RICAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia akari (strain Hartford) GN=gatA PE=3 SV=1 35 531 3.0E-26
sp|Q9ZE10|GATA_RICPR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=gatA PE=3 SV=1 35 531 4.0E-26
sp|Q73VG9|GATA_MYCPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gatA PE=3 SV=1 106 529 4.0E-26
sp|Q5FWT5|GATA_RAT Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Rattus norvegicus GN=Qrsl1 PE=2 SV=1 40 345 4.0E-26
sp|A5CEC8|GATA_ORITB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Boryong) GN=gatA PE=3 SV=1 35 539 4.0E-26
sp|Q29RP9|GATA_BOVIN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Bos taurus GN=QRSL1 PE=2 SV=1 36 345 5.0E-26
sp|C3PMJ0|GATA_RICAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia africae (strain ESF-5) GN=gatA PE=3 SV=1 35 531 5.0E-26
sp|A3PI90|GATA_RHOS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatA PE=3 SV=1 38 529 6.0E-26
sp|A8GQX7|GATA_RICRS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatA PE=3 SV=1 35 531 7.0E-26
sp|B0BWC3|GATA_RICRO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Iowa) GN=gatA PE=3 SV=1 35 531 7.0E-26
sp|C1F857|GATA_ACIC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gatA PE=3 SV=1 93 531 7.0E-26
sp|B2AG25|GATA_CUPTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gatA PE=3 SV=1 40 353 8.0E-26
sp|E0VSP9|GATA_PEDHC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Pediculus humanus subsp. corporis GN=gatA PE=3 SV=1 36 350 8.0E-26
sp|Q48RQ4|GATA_STRPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatA PE=3 SV=1 40 343 9.0E-26
sp|Q8NZM0|GATA_STRP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatA PE=3 SV=1 40 343 9.0E-26
sp|Q1J569|GATA_STRPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatA PE=3 SV=1 40 343 1.0E-25
sp|Q73Q68|GATA_TREDE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gatA PE=3 SV=1 43 528 1.0E-25
sp|B2HIF7|GATA_MYCMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=gatA PE=3 SV=1 106 543 1.0E-25
sp|A0PPX4|GATA_MYCUA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium ulcerans (strain Agy99) GN=gatA PE=3 SV=1 106 543 1.0E-25
sp|Q5XAC7|GATA_STRP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatA PE=3 SV=1 40 343 1.0E-25
sp|Q1QDJ4|GATA_PSYCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter cryohalolentis (strain K5) GN=gatA PE=3 SV=1 35 345 1.0E-25
sp|P0CZ61|GATA_STRPQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatA PE=3 SV=1 40 343 1.0E-25
sp|P0CZ60|GATA_STRP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatA PE=3 SV=1 40 343 1.0E-25
sp|Q5FHN7|GATA_EHRRG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Gardel) GN=gatA PE=3 SV=2 33 489 1.0E-25
sp|Q4FUG4|GATA_PSYA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gatA PE=3 SV=1 35 345 1.0E-25
sp|Q5ZUQ7|GATA_LEGPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatA PE=3 SV=1 40 535 2.0E-25
sp|Q4UKF1|GATA_RICFE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatA PE=3 SV=1 35 531 2.0E-25
sp|Q21RH9|GATA_RHOFT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gatA PE=3 SV=1 106 536 2.0E-25
sp|Q1JKC7|GATA_STRPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatA PE=3 SV=1 40 343 2.0E-25
sp|Q1JA74|GATA_STRPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatA PE=3 SV=1 40 343 2.0E-25
sp|E0CTY1|GATA_VITVI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Vitis vinifera GN=GATA PE=3 SV=1 54 531 2.0E-25
sp|Q1JFB9|GATA_STRPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatA PE=3 SV=1 40 343 2.0E-25
sp|A2RCV7|GATA_STRPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatA PE=3 SV=1 40 343 2.0E-25
sp|Q9CZN8|GATA_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Mus musculus GN=Qrsl1 PE=1 SV=1 40 345 2.0E-25
sp|Q3J459|GATA_RHOS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatA PE=3 SV=1 38 529 2.0E-25
sp|B3PC08|GATA_CELJU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cellvibrio japonicus (strain Ueda107) GN=gatA PE=3 SV=1 36 530 3.0E-25
sp|Q2IXB7|GATA_RHOP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain HaA2) GN=gatA PE=3 SV=1 35 345 3.0E-25
sp|A5ICP2|GATA_LEGPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Corby) GN=gatA PE=3 SV=1 40 345 3.0E-25
sp|B0TWN0|GATA_FRAP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gatA PE=3 SV=1 41 358 3.0E-25
sp|Q99YC0|GATA_STRP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M1 GN=gatA PE=3 SV=1 40 343 4.0E-25
sp|Q28T24|GATA_JANSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Jannaschia sp. (strain CCS1) GN=gatA PE=3 SV=1 35 529 4.0E-25
sp|Q6AEE8|GATA_LEIXX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gatA PE=3 SV=1 51 528 5.0E-25
sp|Q3SR31|GATA_NITWN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gatA PE=3 SV=1 35 529 5.0E-25
sp|Q9Z9G7|GATA_CHLPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia pneumoniae GN=gatA PE=3 SV=1 36 279 6.0E-25
sp|B5XHZ9|GATA_STRPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatA PE=3 SV=1 40 343 7.0E-25
sp|C0R5M6|GATA_WOLWR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatA PE=3 SV=1 35 345 8.0E-25
sp|Q5M312|GATA_STRT2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gatA PE=3 SV=1 40 530 8.0E-25
sp|Q5LYE9|GATA_STRT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gatA PE=3 SV=1 40 530 8.0E-25
sp|Q8F3A1|GATA_LEPIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gatA PE=3 SV=1 35 345 8.0E-25
sp|Q49091|GATA_MORCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moraxella catarrhalis GN=gatA PE=3 SV=1 35 345 8.0E-25
sp|Q8DSG5|GATA_STRMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatA PE=3 SV=1 106 530 8.0E-25
sp|B3Q9W5|GATA_RHOPT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain TIE-1) GN=gatA PE=3 SV=1 35 345 9.0E-25
sp|Q6N575|GATA_RHOPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gatA PE=3 SV=1 35 345 9.0E-25
sp|A8EXM1|GATA_RICCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia canadensis (strain McKiel) GN=gatA PE=3 SV=1 46 531 1.0E-24
sp|B3CMT8|GATA_WOLPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatA PE=3 SV=1 35 528 1.0E-24
sp|A6UQF6|GATA_METVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatA PE=3 SV=1 57 345 1.0E-24
sp|Q29BT3|GATA_DROPS Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=gatA PE=3 SV=2 67 343 1.0E-24
sp|B0SRP1|GATA_LEPBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gatA PE=3 SV=1 35 344 1.0E-24
sp|B0S8V3|GATA_LEPBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gatA PE=3 SV=1 35 344 1.0E-24
sp|A0QJD4|GATA_MYCA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium avium (strain 104) GN=gatA PE=3 SV=1 106 529 2.0E-24
sp|Q8NR17|GATA_CORGL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gatA PE=3 SV=1 31 531 2.0E-24
sp|A1BDI1|GATA_CHLPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gatA PE=3 SV=1 36 358 2.0E-24
sp|Q72SC3|GATA_LEPIC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gatA PE=3 SV=1 43 345 2.0E-24
sp|A4QDK8|GATA_CORGB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium glutamicum (strain R) GN=gatA PE=3 SV=1 31 531 2.0E-24
sp|Q8DY25|GATA_STRA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatA PE=3 SV=1 40 530 2.0E-24
sp|Q3JZM1|GATA_STRA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatA PE=3 SV=1 40 530 2.0E-24
sp|Q0BZV5|GATA_HYPNA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hyphomonas neptunium (strain ATCC 15444) GN=gatA PE=3 SV=1 35 529 3.0E-24
sp|O33105|GATA_MYCLE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycobacterium leprae (strain TN) GN=gatA PE=3 SV=1 106 543 3.0E-24
sp|C1C5H2|GATA_STRP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain 70585) GN=gatA PE=3 SV=1 40 530 4.0E-24
sp|Q135J7|GATA_RHOPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisB5) GN=gatA PE=3 SV=1 35 345 4.0E-24
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094470
MLRLHYLTYIVVFFLFGDVLACLASTQAGTGTFPDLYEASVEELQEGLDAGIFTSVDLVKAYFARIDEVNLKGPA
LRAVLELNPMALSQAAELDRERRATGKRGHLHGIPILLKDNIATDASEGMNTTAGSFSLLGSIVPGDAGVVKRLR
RAGAIILGKANMSEWAHYRGKIPSGWSGRGLQCTNAYFPNADPCGSSSGSGVGASIGLAAVTLGTETDGSITCPS
SHNNLAGIKPTVGLTSRAGVIPISAHHDTVGPMTRSIADAAIVLSVIAGKDPNDNFTLAQPDRVPDYTRALRKNA
LKGKRIGVPRHVFLNSSISGDDPSMIAAFEQALDVIRKLGATVVDPANIPSAEEIIGSNNETIVLNTEFKVQLNQ
WFESLIKNPSGVRSLADLIQFNDLNPDLEEPPQFTDQSQLIEVEATQGFDDAYFAALAFDEDLGATRGIDAALKR
HKLDALVLPATGFTAGPAALVGYPIVTVPLGFFPDNVPIGRAGPNLVYPAPGVPFGLSFFGTAFSEFDLIGFGYA
YEQATKTRLARRAFPDAIPKTQLKDVVRN*
Coding >AgabiH97|094470
ATGCTTCGTTTGCATTATCTGACTTACATAGTTGTATTTTTCCTGTTCGGGGACGTACTTGCCTGTCTTGCGAGC
ACTCAAGCTGGCACGGGGACATTTCCTGACCTCTACGAGGCCTCTGTGGAAGAGCTTCAAGAGGGACTAGATGCT
GGGATATTTACCAGCGTCGACCTCGTCAAGGCGTACTTTGCTCGTATAGATGAAGTCAATCTAAAGGGTCCAGCA
TTGCGTGCAGTGCTCGAATTGAATCCTATGGCTCTATCTCAAGCTGCTGAATTGGATCGTGAGCGGAGGGCAACA
GGCAAACGGGGCCACCTGCATGGAATTCCTATACTGCTCAAAGACAATATTGCTACCGATGCTTCAGAAGGCATG
AACACGACTGCGGGTTCTTTCAGCCTCCTTGGTTCGATCGTTCCAGGTGACGCTGGTGTGGTCAAGCGGCTTAGG
AGAGCGGGAGCTATCATACTTGGCAAAGCAAATATGTCAGAGTGGGCACATTACCGAGGTAAAATACCGTCTGGT
TGGTCTGGGCGCGGCCTCCAGTGCACGAATGCATATTTCCCAAATGCCGACCCTTGCGGCTCATCCTCTGGTTCG
GGTGTTGGTGCATCTATTGGTCTTGCAGCTGTTACGCTCGGAACAGAAACAGATGGAAGTATTACATGTCCTTCC
AGTCATAATAACCTAGCGGGTATCAAGCCGACCGTTGGATTGACCTCTCGGGCAGGAGTCATACCAATCTCCGCA
CACCATGACACTGTTGGGCCTATGACGAGGTCGATCGCTGATGCTGCCATTGTGTTATCCGTGATTGCGGGAAAG
GACCCAAACGACAACTTCACCCTTGCTCAACCCGATCGGGTTCCTGATTATACCCGGGCGTTGAGAAAGAATGCT
CTGAAAGGAAAACGAATTGGGGTCCCTCGACATGTATTCCTGAATAGTTCGATATCTGGCGATGATCCTTCAATG
ATTGCTGCCTTTGAACAAGCCCTTGACGTTATTCGTAAACTCGGTGCGACAGTGGTAGATCCTGCCAATATCCCT
TCTGCCGAAGAAATTATCGGGTCGAACAATGAAACTATCGTTCTTAACACCGAGTTTAAAGTTCAACTAAACCAA
TGGTTTGAGTCTCTTATCAAAAATCCGTCCGGAGTTCGCAGCCTTGCTGATCTCATTCAATTCAATGACCTTAAC
CCTGACCTTGAAGAGCCACCTCAATTCACAGATCAATCTCAACTCATCGAAGTAGAGGCTACGCAGGGTTTCGAT
GATGCCTATTTTGCTGCACTCGCCTTCGACGAAGATCTCGGGGCGACGCGGGGCATCGATGCCGCTCTTAAACGC
CATAAGCTTGACGCATTAGTTCTTCCGGCTACAGGATTTACTGCCGGTCCGGCAGCCCTTGTAGGATACCCAATC
GTTACTGTTCCTCTTGGTTTCTTCCCGGACAATGTTCCAATTGGACGTGCTGGGCCTAATCTCGTTTACCCTGCA
CCAGGTGTTCCGTTCGGACTTTCGTTCTTTGGAACTGCATTTTCTGAATTCGACTTGATCGGTTTTGGCTATGCG
TATGAACAAGCGACAAAGACTCGGTTGGCGAGAAGGGCCTTCCCAGATGCCATTCCTAAGACTCAATTGAAAGAC
GTTGTCCGGAATTAG
Transcript >AgabiH97|094470
ATGCTTCGTTTGCATTATCTGACTTACATAGTTGTATTTTTCCTGTTCGGGGACGTACTTGCCTGTCTTGCGAGC
ACTCAAGCTGGCACGGGGACATTTCCTGACCTCTACGAGGCCTCTGTGGAAGAGCTTCAAGAGGGACTAGATGCT
GGGATATTTACCAGCGTCGACCTCGTCAAGGCGTACTTTGCTCGTATAGATGAAGTCAATCTAAAGGGTCCAGCA
TTGCGTGCAGTGCTCGAATTGAATCCTATGGCTCTATCTCAAGCTGCTGAATTGGATCGTGAGCGGAGGGCAACA
GGCAAACGGGGCCACCTGCATGGAATTCCTATACTGCTCAAAGACAATATTGCTACCGATGCTTCAGAAGGCATG
AACACGACTGCGGGTTCTTTCAGCCTCCTTGGTTCGATCGTTCCAGGTGACGCTGGTGTGGTCAAGCGGCTTAGG
AGAGCGGGAGCTATCATACTTGGCAAAGCAAATATGTCAGAGTGGGCACATTACCGAGGTAAAATACCGTCTGGT
TGGTCTGGGCGCGGCCTCCAGTGCACGAATGCATATTTCCCAAATGCCGACCCTTGCGGCTCATCCTCTGGTTCG
GGTGTTGGTGCATCTATTGGTCTTGCAGCTGTTACGCTCGGAACAGAAACAGATGGAAGTATTACATGTCCTTCC
AGTCATAATAACCTAGCGGGTATCAAGCCGACCGTTGGATTGACCTCTCGGGCAGGAGTCATACCAATCTCCGCA
CACCATGACACTGTTGGGCCTATGACGAGGTCGATCGCTGATGCTGCCATTGTGTTATCCGTGATTGCGGGAAAG
GACCCAAACGACAACTTCACCCTTGCTCAACCCGATCGGGTTCCTGATTATACCCGGGCGTTGAGAAAGAATGCT
CTGAAAGGAAAACGAATTGGGGTCCCTCGACATGTATTCCTGAATAGTTCGATATCTGGCGATGATCCTTCAATG
ATTGCTGCCTTTGAACAAGCCCTTGACGTTATTCGTAAACTCGGTGCGACAGTGGTAGATCCTGCCAATATCCCT
TCTGCCGAAGAAATTATCGGGTCGAACAATGAAACTATCGTTCTTAACACCGAGTTTAAAGTTCAACTAAACCAA
TGGTTTGAGTCTCTTATCAAAAATCCGTCCGGAGTTCGCAGCCTTGCTGATCTCATTCAATTCAATGACCTTAAC
CCTGACCTTGAAGAGCCACCTCAATTCACAGATCAATCTCAACTCATCGAAGTAGAGGCTACGCAGGGTTTCGAT
GATGCCTATTTTGCTGCACTCGCCTTCGACGAAGATCTCGGGGCGACGCGGGGCATCGATGCCGCTCTTAAACGC
CATAAGCTTGACGCATTAGTTCTTCCGGCTACAGGATTTACTGCCGGTCCGGCAGCCCTTGTAGGATACCCAATC
GTTACTGTTCCTCTTGGTTTCTTCCCGGACAATGTTCCAATTGGACGTGCTGGGCCTAATCTCGTTTACCCTGCA
CCAGGTGTTCCGTTCGGACTTTCGTTCTTTGGAACTGCATTTTCTGAATTCGACTTGATCGGTTTTGGCTATGCG
TATGAACAAGCGACAAAGACTCGGTTGGCGAGAAGGGCCTTCCCAGATGCCATTCCTAAGACTCAATTGAAAGAC
GTTGTCCGGAATTAG
Gene >AgabiH97|094470
ATGCTTCGTTTGCATTATCTGACTTACATAGTTGTATTTTTCCTGTTCGGGGACGTACTTGCCTGTCTTGCGAGC
ACTCAAGCTGGCACGGGGACATTTCCTGACCTCTACGAGGCCTCTGTGGAAGAGCTTCAAGAGGGACTAGATGCT
GGGATATTTACCAGCGTCGACCTCGTCAAGGTCAGTTCCCCCCAAGTTTACTCAGAGTCGTTTCAAAGCTAAAGG
CTAAAATATAGGCGTACTTTGCTCGTATAGATGAAGTCAATCTAAAGGGTCCAGCATTGCGTGCAGTGCTCGAAT
TGAATCCTATGGCTCTATCTCAAGCTGCTGAATTGGATCGTGAGCGGAGGGCAACAGGCAAACGGGGCCACCTGC
ATGGAATTCCTATACTGCTCAAAGTAAGCGATCTTGGTCCGTAGCTACGTGCGTTGTATATCTGAATCGGCTTGT
AGGACAATATTGCTACCGATGCTTCAGAAGGTGCGCGCCTATGGAATTATGATGATTGTCCGTCAATATTCAGCA
CAAAATAGGCATGAACACGACTGCGGGTTCTTTCAGCCTCCTTGGTTCGATCGTTCCAGGTGACGCTGGTGTGGT
CAAGCGGCTTAGGAGAGCGGGAGCTATCATACTTGGTGAGGCGTGACCCCATATTCCTTGAGACACATCCTTGTA
AGGAAGCTCACCTTTTGAAATAGGCAAAGCAAATATGTCAGAGTGGGCACATTACCGAGGTAAAATACCGTCTGG
TTGGTCTGGGCGCGGCCTCCAGTGCACGAATGCATATTTCCCAAATGCCGACCCTTGCGGCTCATCCTCTGGTTC
GGGTGTTGGTGCATCTATTGGTCTTGCAGCTGTTACGCTCGGAACAGAAACAGATGGAAGTATTACATGTCCTTC
CAGTCATAATAACCTAGCGGGTATCAAGCCGACCGTTGGATTGACCTCTCGGGCAGGAGGTAAGAAATTTTGAGA
TTACTTGCCAGGAGCAAAAGAACTGAAATACTTCTAGTCATACCAATCTCCGCACACCATGACACTGTTGGGCCT
ATGACGAGGTCGATCGCTGATGCTGCCATTGTGTTATCCGTGATTGCGGGAAAGGACCCAAACGACAACTTCACC
CTTGCTCAACCCGATCGGGTTCCTGATTATACCCGGGCGTTGAGAAAGAATGCTCTGAAAGGAAAACGAATTGGG
GTCCCTCGACATGTATTCCTGAATAGTTCGATATCTGGCGATGATCCTTCAATGATTGCTGCCTTTGAACAAGCC
CTTGACGTTATTCGTAAACTCGGTGCGACAGTGGTAGATCCTGCCAATATCCCTTCTGCCGAAGAAATTATCGGG
TCGAACAATGAAACTATCGTTCTTAACACCGAGTTTAAAGTAATCATTTGCCTCTTAGCACCTCTTTCTGGTCTG
ATATTTCTCTAGGTTCAACTAAACCAATGGTTTGAGTCTCTTATCAAAAATCCGTCCGGAGTTCGCAGCCTTGCT
GATCTCATTCAATTCAATGACCTTAACCCTGACCTTGAAGAGCCACCTCAATTCACAGATCAATCTCAGTATGTT
TCTGTCAGTCGGATTTTGTATGTATTGCTTACAGTGGTACATAGACTCATCGAAGTAGAGGCTACGCAGGGTTTC
GATGATGCCTATTTTGCTGCACTCGCCTTCGACGAAGATCTCGGGGCGACGCGGGGCATCGATGCCGCTCTTAAA
CGCCATAAGCTTGACGCATTAGTTCTTCCGGCTACAGGATTTACTGCCGGTCCGGCAGGTAAGCTACTCTCTCAT
TATCATCGTAATGAACGAAGTCCGAATATGCATCTAGCCCTTGTAGGATACCCAATCGTTACTGGTGCGCATGAT
TATCTTCTCATTTCGACTCGAATCTACTTAACCACCACAGTTCCTCTTGGTTTCTTCCCGGACAATGTTCCAATT
GGACGTGCTGGGCCTAATCTCGTTTACCCTGCACCAGGTGTTCCGTTCGGACTTTCGTTCTTTGGAACTGCATTT
TCTGAATTCGACTTGATCGGTTTTGGCTATGCGTATGAACAAGCGACAAAGACTCGGTTGGCGAGAAGGGCCTTC
CCAGATGCCATTCCTAAGACTCAATTGAAAGACGTTGTCCGGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail