Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094390
Gene name
Locationscaffold_6:1581695..1582870
Strand+
Gene length (bp)1175
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 5.1E-10 1 44
PF00646 F-box F-box domain 1.6E-04 3 33

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6408 0.5401 0.0912 0.0715 0.3742 0.0054 0.1098 0.173 0.0537 0.009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 69.31 40.71 97.92
Initials Initials knots 23.15 12.38 33.92
Pileal_Stipeal_center Stage I stipe center 55.47 32.75 78.19
Pileal_Stipeal_shell Stage I stipe shell 51.58 30.32 72.84
DIF_stipe_center Stage II stipe center 79.43 47.82 111.04
DIF_stipe_shell Stage II stipe shell 62.05 37.03 87.07
DIF_stipe_skin Stage II stipe skin 48.78 28.59 68.97
DIF_cap_skin Stage II cap skin 58.12 34.60 81.65
DIF_cap_tissue Stage II cap tissue 60.00 35.75 84.25
DIF_gill_tissue Stage II gill tissue 57.79 34.33 81.24
YFB_stipe_center Young fruiting body stipe center 77.28 45.31 109.26
YFB_stipe_shell Young fruiting body stipe shell 81.01 48.97 113.05
YFB_stipe_skin Young fruiting body stipe skin 69.04 41.28 96.80
YFB_cap_skin Young fruiting body cap skin 56.87 33.76 79.97
YFB_cap_tissue Young fruiting body cap tissue 83.61 50.80 116.41
YFB_gill_tissue Young fruiting body gill tissue 49.27 28.87 69.67
YFB_veil Young fruiting body veil 56.83 33.60 80.07

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.665514 no
Casing YFB_stipe_center 0.824607 no
Casing YFB_stipe_shell 0.723786 no
Casing YFB_stipe_skin 0.994280 no
Casing YFB_cap_skin 0.622614 no
Casing YFB_cap_tissue 0.642169 no
Casing YFB_gill_tissue 0.327476 no
Casing YFB_veil 0.623825 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.564362 no
Casing Pileal_Stipeal_shell 0.412449 no
Casing DIF_stipe_center 0.765500 no
Casing DIF_stipe_shell 0.820754 no
Casing DIF_stipe_skin 0.302693 no
Casing DIF_cap_skin 0.676561 no
Casing DIF_cap_tissue 0.752670 no
DIF_gill_tissue YFB_stipe_center 0.392110 no
DIF_gill_tissue YFB_stipe_shell 0.277589 no
DIF_gill_tissue YFB_stipe_skin 0.646259 no
DIF_gill_tissue YFB_cap_skin 0.977403 no
DIF_gill_tissue YFB_cap_tissue 0.221143 no
DIF_gill_tissue YFB_gill_tissue 0.712686 no
DIF_gill_tissue YFB_veil 0.976227 no
YFB_stipe_center YFB_stipe_shell 0.930799 no
YFB_stipe_center YFB_stipe_skin 0.805948 no
YFB_stipe_center YFB_cap_skin 0.349896 no
YFB_stipe_center YFB_cap_tissue 0.876194 no
YFB_stipe_center YFB_gill_tissue 0.139851 no
YFB_stipe_center YFB_veil 0.354742 no
YFB_stipe_shell YFB_stipe_skin 0.690086 no
YFB_stipe_shell YFB_cap_skin 0.244911 no
YFB_stipe_shell YFB_cap_tissue 0.954792 no
YFB_stipe_shell YFB_gill_tissue 0.085220 no
YFB_stipe_shell YFB_veil 0.251119 no
YFB_stipe_skin YFB_cap_skin 0.608198 no
YFB_stipe_skin YFB_cap_tissue 0.609082 no
YFB_stipe_skin YFB_gill_tissue 0.298244 no
YFB_stipe_skin YFB_veil 0.610358 no
YFB_cap_skin YFB_cap_tissue 0.194366 no
YFB_cap_skin YFB_gill_tissue 0.746225 no
YFB_cap_skin YFB_veil 0.998697 no
YFB_cap_tissue YFB_gill_tissue 0.066767 no
YFB_cap_tissue YFB_veil 0.201633 no
YFB_gill_tissue YFB_veil 0.753853 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.008121 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.002525 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.009773 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.943135 no
Pileal_Stipeal_center YFB_stipe_center 0.305510 no
Pileal_Stipeal_center YFB_stipe_shell 0.215732 no
Pileal_Stipeal_center YFB_stipe_skin 0.550636 no
Pileal_Stipeal_center YFB_cap_skin 0.965656 no
Pileal_Stipeal_center YFB_cap_tissue 0.164893 no
Pileal_Stipeal_center YFB_gill_tissue 0.804297 no
Pileal_Stipeal_center YFB_veil 0.966338 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.893638 no
Pileal_Stipeal_center DIF_stipe_center 0.248983 no
Pileal_Stipeal_center DIF_stipe_shell 0.812439 no
Pileal_Stipeal_center DIF_stipe_skin 0.778030 no
Pileal_Stipeal_center DIF_cap_skin 0.934603 no
Pileal_Stipeal_center DIF_cap_tissue 0.879992 no
Pileal_Stipeal_shell DIF_gill_tissue 0.810482 no
Pileal_Stipeal_shell YFB_stipe_center 0.191220 no
Pileal_Stipeal_shell YFB_stipe_shell 0.127200 no
Pileal_Stipeal_shell YFB_stipe_skin 0.395957 no
Pileal_Stipeal_shell YFB_cap_skin 0.841831 no
Pileal_Stipeal_shell YFB_cap_tissue 0.093666 no
Pileal_Stipeal_shell YFB_gill_tissue 0.935614 no
Pileal_Stipeal_shell YFB_veil 0.844554 no
Pileal_Stipeal_shell DIF_stipe_center 0.149896 no
Pileal_Stipeal_shell DIF_stipe_shell 0.652284 no
Pileal_Stipeal_shell DIF_stipe_skin 0.918159 no
Pileal_Stipeal_shell DIF_cap_skin 0.795508 no
Pileal_Stipeal_shell DIF_cap_tissue 0.729898 no
DIF_stipe_center DIF_gill_tissue 0.327300 no
DIF_stipe_center YFB_stipe_center 0.960633 no
DIF_stipe_center YFB_stipe_shell 0.971923 no
DIF_stipe_center YFB_stipe_skin 0.742496 no
DIF_stipe_center YFB_cap_skin 0.286505 no
DIF_stipe_center YFB_cap_tissue 0.922711 no
DIF_stipe_center YFB_gill_tissue 0.104587 no
DIF_stipe_center YFB_veil 0.291240 no
DIF_stipe_center DIF_stipe_shell 0.486807 no
DIF_stipe_center DIF_stipe_skin 0.086914 no
DIF_stipe_center DIF_cap_skin 0.334798 no
DIF_stipe_center DIF_cap_tissue 0.410403 no
DIF_stipe_shell DIF_gill_tissue 0.893296 no
DIF_stipe_shell YFB_stipe_center 0.565243 no
DIF_stipe_shell YFB_stipe_shell 0.441778 no
DIF_stipe_shell YFB_stipe_skin 0.821524 no
DIF_stipe_shell YFB_cap_skin 0.862827 no
DIF_stipe_shell YFB_cap_tissue 0.360945 no
DIF_stipe_shell YFB_gill_tissue 0.547643 no
DIF_stipe_shell YFB_veil 0.862800 no
DIF_stipe_shell DIF_stipe_skin 0.512710 no
DIF_stipe_shell DIF_cap_skin 0.904092 no
DIF_stipe_shell DIF_cap_tissue 0.953647 no
DIF_stipe_skin DIF_gill_tissue 0.692496 no
DIF_stipe_skin YFB_stipe_center 0.115496 no
DIF_stipe_skin YFB_stipe_shell 0.072330 no
DIF_stipe_skin YFB_stipe_skin 0.275437 no
DIF_stipe_skin YFB_cap_skin 0.722850 no
DIF_stipe_skin YFB_cap_tissue 0.053965 no
DIF_stipe_skin YFB_gill_tissue 0.986610 no
DIF_stipe_skin YFB_veil 0.727581 no
DIF_stipe_skin DIF_cap_skin 0.674636 no
DIF_stipe_skin DIF_cap_tissue 0.600264 no
DIF_cap_skin DIF_gill_tissue 0.991807 no
DIF_cap_skin YFB_stipe_center 0.407219 no
DIF_cap_skin YFB_stipe_shell 0.297304 no
DIF_cap_skin YFB_stipe_skin 0.663665 no
DIF_cap_skin YFB_cap_skin 0.969639 no
DIF_cap_skin YFB_cap_tissue 0.236030 no
DIF_cap_skin YFB_gill_tissue 0.699718 no
DIF_cap_skin YFB_veil 0.968292 no
DIF_cap_skin DIF_cap_tissue 0.955047 no
DIF_cap_tissue DIF_gill_tissue 0.947556 no
DIF_cap_tissue YFB_stipe_center 0.483821 no
DIF_cap_tissue YFB_stipe_shell 0.364751 no
DIF_cap_tissue YFB_stipe_skin 0.743453 no
DIF_cap_tissue YFB_cap_skin 0.922099 no
DIF_cap_tissue YFB_cap_tissue 0.296798 no
DIF_cap_tissue YFB_gill_tissue 0.624459 no
DIF_cap_tissue YFB_veil 0.920292 no

Orthologs

Orthofinder run ID1
Orthogroup6875
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|094390
Agaricus bisporus var bisporus H97 AgabiH97|094390 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|61_18

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094390
MPSLPNEILAAIFSRLEPATLAQLTTVSRRLNAVAEYHLYSLISFTDVLTDALHVPQRTVSWCHAMLNRPHLVDA
VKRLHIRWTTEYHSPPTPLLLAVCDQLSLVIRSCVGLEYLDLFLGPANFASLPRENMHAIERAVFLCSLPALRYC
SLGADYAKGIQPYTAHIVSFLSHTPSLQHLRLADHHASLNLPPGSHVLPLLHTFRGSAATAATILPGRPVRYLSL
VGQDSDVTQENLLRMASTSTPLRSLDLSAISARPVLLRNVSSYLPTLERLRIRLALRHTLHYALSGISLLVGLSS
VLSKFPNLVYLDLSPTLEGGRANPADERVLCTEYGRACPSIRTIVFPSQAEWSLDNEGQWCMAEF*
Coding >AgabiH97|094390
ATGCCTTCTCTTCCCAACGAAATCCTTGCTGCCATCTTTTCCCGTCTCGAGCCTGCGACCCTCGCCCAGCTCACC
ACCGTCTCCCGCCGTCTCAACGCTGTTGCAGAGTATCATCTCTATTCGCTAATCTCCTTTACTGATGTCCTCACC
GACGCACTCCATGTCCCCCAGCGGACCGTCTCCTGGTGCCATGCCATGCTCAACAGACCCCATCTCGTGGACGCC
GTCAAACGCCTCCACATCCGCTGGACAACAGAGTACCATTCTCCTCCTACTCCCCTCCTCCTCGCAGTGTGCGAC
CAGCTTTCTCTTGTCATCCGCAGTTGCGTCGGTCTAGAATACCTTGACCTGTTCCTCGGCCCCGCAAACTTCGCC
TCACTGCCGAGAGAGAACATGCATGCCATTGAACGTGCCGTCTTTCTTTGTTCTCTCCCAGCCCTTCGTTATTGC
TCCCTCGGTGCAGATTACGCGAAAGGCATCCAGCCATACACCGCACACATCGTCTCTTTTCTCTCGCACACTCCC
TCCCTTCAACATCTCCGCCTTGCAGATCATCATGCCTCTCTCAACCTCCCCCCAGGCTCGCATGTCCTTCCCCTC
CTTCACACATTTCGTGGATCTGCTGCCACTGCCGCCACCATCCTCCCTGGGCGTCCTGTCCGCTATCTTTCTCTC
GTTGGTCAAGACTCAGACGTCACACAAGAGAATCTATTGCGCATGGCATCAACCTCTACCCCCCTCCGATCCCTA
GACTTATCCGCCATCTCTGCACGACCTGTTCTTTTGCGCAATGTGTCCTCTTATCTGCCCACCCTTGAACGCCTG
CGTATAAGGCTCGCTCTACGCCATACCCTCCACTATGCCCTTTCCGGTATTAGTTTACTTGTTGGTCTTTCCTCC
GTCCTCAGCAAGTTTCCGAATCTGGTCTACCTCGATCTGTCACCTACGTTAGAAGGTGGCCGTGCCAATCCAGCA
GATGAGAGGGTACTGTGCACAGAGTATGGCCGAGCATGTCCTTCCATCAGGACCATAGTCTTTCCCTCGCAGGCA
GAGTGGTCTCTCGACAATGAGGGTCAGTGGTGCATGGCCGAATTCTGA
Transcript >AgabiH97|094390
ATGCCTTCTCTTCCCAACGAAATCCTTGCTGCCATCTTTTCCCGTCTCGAGCCTGCGACCCTCGCCCAGCTCACC
ACCGTCTCCCGCCGTCTCAACGCTGTTGCAGAGTATCATCTCTATTCGCTAATCTCCTTTACTGATGTCCTCACC
GACGCACTCCATGTCCCCCAGCGGACCGTCTCCTGGTGCCATGCCATGCTCAACAGACCCCATCTCGTGGACGCC
GTCAAACGCCTCCACATCCGCTGGACAACAGAGTACCATTCTCCTCCTACTCCCCTCCTCCTCGCAGTGTGCGAC
CAGCTTTCTCTTGTCATCCGCAGTTGCGTCGGTCTAGAATACCTTGACCTGTTCCTCGGCCCCGCAAACTTCGCC
TCACTGCCGAGAGAGAACATGCATGCCATTGAACGTGCCGTCTTTCTTTGTTCTCTCCCAGCCCTTCGTTATTGC
TCCCTCGGTGCAGATTACGCGAAAGGCATCCAGCCATACACCGCACACATCGTCTCTTTTCTCTCGCACACTCCC
TCCCTTCAACATCTCCGCCTTGCAGATCATCATGCCTCTCTCAACCTCCCCCCAGGCTCGCATGTCCTTCCCCTC
CTTCACACATTTCGTGGATCTGCTGCCACTGCCGCCACCATCCTCCCTGGGCGTCCTGTCCGCTATCTTTCTCTC
GTTGGTCAAGACTCAGACGTCACACAAGAGAATCTATTGCGCATGGCATCAACCTCTACCCCCCTCCGATCCCTA
GACTTATCCGCCATCTCTGCACGACCTGTTCTTTTGCGCAATGTGTCCTCTTATCTGCCCACCCTTGAACGCCTG
CGTATAAGGCTCGCTCTACGCCATACCCTCCACTATGCCCTTTCCGGTATTAGTTTACTTGTTGGTCTTTCCTCC
GTCCTCAGCAAGTTTCCGAATCTGGTCTACCTCGATCTGTCACCTACGTTAGAAGGTGGCCGTGCCAATCCAGCA
GATGAGAGGGTACTGTGCACAGAGTATGGCCGAGCATGTCCTTCCATCAGGACCATAGTCTTTCCCTCGCAGGCA
GAGTGGTCTCTCGACAATGAGGGTCAGTGGTGCATGGCCGAATTCTGA
Gene >AgabiH97|094390
ATGCCTTCTCTTCCCAACGAAATCCTTGCTGCCATCTTTTCCCGTCTCGAGCCTGCGACCCTCGCCCAGCTCACC
ACCGTCTCCCGCCGTCTCAACGCTGTTGCAGAGTATCATCTCTATTCGCTAATCTCCTTTACTGATGTCCTCACC
GACGCACTCCATGTCCCCCAGCGGACCGTCTCCTGGTGCCATGCCATGCTCAACAGACCCCATCTCGTGGACGCC
GTCAAACGCCTCCACATCCGCTGGACAACAGAGTACCATTCTCCTCCTACTCCCCTCCTCCTCGCAGTGTGCGAC
CAGCTTTCTCTTGTCATCCGCAGTTGCGTCGGTCTAGAATACCTTGACCTGTTCCTCGGCCCCGCAAACTTCGCC
TCACTGCCGAGAGAGAACATGCATGCCATTGAACGTGCCGTCTTTCTTTGTTCTCTCCCAGCCCTTCGTTATTGC
TCCCTCGGTGCAGATTACGCGAAAGGCATCCAGCCATACACCGCACACATCGTCTCTTTTCTCTCGCACACTCCC
TCCCTTCAACATCTCCGCCTTGCAGATCATCATGCCTCTCTCAACCTCCCCCCAGGCTCGCATGTCCTTCCCCTC
CTTCACACATTTCGTGGATCTGCTGCCACTGCCGCCACCATCCTCCCTGGGCGTCCTGTCCGCTATCTTTCTCTC
GTTGGTCAAGACTCAGACGTCACACAAGAGAATCTATTGCGCATGGCATCAACCTCTACCCCCCTCCGATCCCTA
GACTTATCCGCCATCTCTGCACGACCTGTTCTTTTGCGCAATGTGTCCTCTTATCTGCCCACCCTTGAACGCCTG
CGTATAAGGCTCGCTCTACGCCATACCCTCCACTATGCCCTTTCCGGTATTGTGAGTACCGCTCTTTCTCTATCT
AATATATAAATAGATTTTGCATGCCATTGCTCATTATGATTGTACAACGACAGAGTTTACTTGTTGGTCTTTCCT
CCGTCCTCAGCAAGTTTCCGAATCTGGTCTACCTCGATCTGTCACCTACGTTAGAAGGTGGCCGTGCCAATCCAG
CAGATGAGAGGGTACTGTGCACAGAGTATGGCCGAGCATGTCCTTCCATCAGGACCATAGTCTTTCCCTCGCAGG
CAGAGTGGTCTCTCGACAATGAGGGTCAGTGGTGCATGGCCGAATTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail