Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094380
Gene name
Locationscaffold_6:1581137..1581668
Strand+
Gene length (bp)531
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 1.3E-06 39 97
PF02969 TAF TATA box binding protein associated factor (TAF) 7.4E-05 34 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P62792|H4_PHACH Histone H4 OS=Phanerochaete chrysosporium GN=H4.1 PE=3 SV=2 1 98 2.0E-60
sp|P62793|H4_AGABI Histone H4 OS=Agaricus bisporus GN=hhfA PE=3 SV=2 1 98 2.0E-60
sp|Q9U7D0|H4_MASBA Histone H4 OS=Mastigamoeba balamuthi PE=3 SV=3 1 98 5.0E-51
sp|P62791|H4_STYLE Histone H4 OS=Stylonychia lemnae PE=3 SV=2 1 98 5.0E-47
sp|P62790|H4_STENO Histone H4 OS=Sterkiella nova PE=3 SV=2 1 98 5.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P62792|H4_PHACH Histone H4 OS=Phanerochaete chrysosporium GN=H4.1 PE=3 SV=2 1 98 2.0E-60
sp|P62793|H4_AGABI Histone H4 OS=Agaricus bisporus GN=hhfA PE=3 SV=2 1 98 2.0E-60
sp|Q9U7D0|H4_MASBA Histone H4 OS=Mastigamoeba balamuthi PE=3 SV=3 1 98 5.0E-51
sp|P62791|H4_STYLE Histone H4 OS=Stylonychia lemnae PE=3 SV=2 1 98 5.0E-47
sp|P62790|H4_STENO Histone H4 OS=Sterkiella nova PE=3 SV=2 1 98 5.0E-47
sp|P62786|H42_WHEAT Histone H4 variant TH091 OS=Triticum aestivum PE=3 SV=2 15 98 5.0E-46
sp|Q27765|H4_STYPL Histone H4 OS=Styela plicata PE=3 SV=3 1 98 6.0E-46
sp|Q8I0Y4|H4_OIKDI Histone H4 OS=Oikopleura dioica GN=H4.1 PE=3 SV=3 1 98 6.0E-46
sp|Q6LAF1|H4_DENKL Histone H4 OS=Dendronephthya klunzingeri GN=H4DEKL PE=3 SV=3 1 98 7.0E-46
sp|P35059|H4_ACRFO Histone H4 OS=Acropora formosa PE=3 SV=2 1 98 7.0E-46
sp|P35057|H4_SOLLC Histone H4 OS=Solanum lycopersicum PE=3 SV=2 1 98 9.0E-46
sp|Q6V9I2|H4_SOLCH Histone H4 OS=Solanum chacoense PE=3 SV=3 1 98 9.0E-46
sp|Q71V09|H4_CAPAN Histone H4 OS=Capsicum annuum PE=3 SV=3 1 98 9.0E-46
sp|Q28DR4|H4_XENTR Histone H4 OS=Xenopus tropicalis GN=TGas006m08.1 PE=3 SV=1 1 98 1.0E-45
sp|P62799|H4_XENLA Histone H4 OS=Xenopus laevis PE=1 SV=2 1 98 1.0E-45
sp|P62798|H4_XENBO Histone H4 OS=Xenopus borealis PE=3 SV=2 1 98 1.0E-45
sp|P62794|H4_URECA Histone H4 OS=Urechis caupo PE=3 SV=2 1 98 1.0E-45
sp|P62804|H4_RAT Histone H4 OS=Rattus norvegicus GN=Hist1h4b PE=1 SV=2 1 98 1.0E-45
sp|Q5RCS7|H4_PONAB Histone H4 OS=Pongo abelii PE=3 SV=1 1 98 1.0E-45
sp|P62795|H4_PLADU Histone H4 OS=Platynereis dumerilii PE=3 SV=2 1 98 1.0E-45
sp|P62802|H4_PIG Histone H4 OS=Sus scrofa PE=1 SV=2 1 98 1.0E-45
sp|P62796|H4_ORENI Histone H4 OS=Oreochromis niloticus PE=3 SV=2 1 98 1.0E-45
sp|P62797|H4_ONCMY Histone H4 OS=Oncorhynchus mykiss PE=1 SV=2 1 98 1.0E-45
sp|Q6WV72|H4_MYTTR Histone H4 OS=Mytilus trossulus PE=3 SV=3 1 98 1.0E-45
sp|Q6WV90|H4_MYTGA Histone H4 OS=Mytilus galloprovincialis PE=3 SV=3 1 98 1.0E-45
sp|Q7K8C0|H4_MYTED Histone H4 OS=Mytilus edulis PE=3 SV=3 1 98 1.0E-45
sp|Q6WV73|H4_MYTCA Histone H4 OS=Mytilus californianus PE=3 SV=3 1 98 1.0E-45
sp|P62806|H4_MOUSE Histone H4 OS=Mus musculus GN=Hist1h4a PE=1 SV=2 1 98 1.0E-45
sp|Q4R362|H4_MACFA Histone H4 OS=Macaca fascicularis GN=QtsA-19327 PE=3 SV=1 1 98 1.0E-45
sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens GN=HIST1H4A PE=1 SV=2 1 98 1.0E-45
sp|P62801|H4_CHICK Histone H4 OS=Gallus gallus GN=H4-I PE=1 SV=2 1 98 1.0E-45
sp|Q7KQD1|H4_CHAVR Histone H4 OS=Chaetopterus variopedatus PE=3 SV=3 1 98 1.0E-45
sp|P62800|H4_CAIMO Histone H4 OS=Cairina moschata PE=3 SV=2 1 98 1.0E-45
sp|P62803|H4_BOVIN Histone H4 OS=Bos taurus PE=1 SV=2 1 98 1.0E-45
sp|P84045|H4_TIGCA Histone H4 OS=Tigriopus californicus GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84050|H4_RHYAM Histone H4 OS=Rhynchosciara americana GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84049|H4_MYRRU Histone H4 OS=Myrmica ruginodis GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84044|H4_DROYA Histone H4 OS=Drosophila yakuba GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|Q76FF5|H4_DROTE Histone H4 OS=Drosophila teissieri GN=His4 PE=3 SV=3 11 98 1.0E-45
sp|P84043|H4_DROSI Histone H4 OS=Drosophila simulans GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|Q76FD9|H4_DROSE Histone H4 OS=Drosophila sechellia GN=His4 PE=3 SV=3 11 98 1.0E-45
sp|Q76FF1|H4_DROOR Histone H4 OS=Drosophila orena GN=His4 PE=3 SV=3 11 98 1.0E-45
sp|P84040|H4_DROME Histone H4 OS=Drosophila melanogaster GN=His4 PE=1 SV=2 11 98 1.0E-45
sp|Q76FE7|H4_DROMA Histone H4 OS=Drosophila mauritiana GN=His4 PE=3 SV=3 11 98 1.0E-45
sp|P84042|H4_DROHY Histone H4 OS=Drosophila hydei GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84041|H4_DROER Histone H4 OS=Drosophila erecta GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84046|H4_CHITH Histone H4 OS=Chironomus thummi thummi GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84047|H4_ASEAQ Histone H4 OS=Asellus aquaticus GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P84048|H4_ACRAS Histone H4 OS=Acrolepiopsis assectella GN=His4 PE=3 SV=2 11 98 1.0E-45
sp|P0CG89|H4_SOYBN Histone H4 OS=Glycine max PE=3 SV=1 1 98 2.0E-45
sp|Q76H85|H4_SILLA Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3 1 98 2.0E-45
sp|P62788|H4_PEA Histone H4 OS=Pisum sativum PE=1 SV=2 1 98 2.0E-45
sp|P62787|H4_MAIZE Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2 1 98 2.0E-45
sp|P62887|H4_LOLTE Histone H4 OS=Lolium temulentum PE=3 SV=2 1 98 2.0E-45
sp|Q6LAF3|H4_FLATR Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3 1 98 2.0E-45
sp|Q6WZ83|H4_EUCGL Histone H4 OS=Eucalyptus globulus PE=3 SV=3 1 98 2.0E-45
sp|Q6PMI5|H4_CHEMJ Histone H4 OS=Chelidonium majus PE=3 SV=3 1 98 2.0E-45
sp|P59259|H4_ARATH Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2 1 98 2.0E-45
sp|P62785|H41_WHEAT Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2 1 98 2.0E-45
sp|Q6WV74|H4_MYTCH Histone H4 OS=Mytilus chilensis PE=3 SV=3 1 98 4.0E-45
sp|Q9HDF5|H4_MORAP Histone H4 OS=Mortierella alpina GN=H4.1 PE=3 SV=3 1 98 4.0E-45
sp|P62783|H4_STRPU Histone H4 OS=Strongylocentrotus purpuratus PE=3 SV=2 1 98 5.0E-45
sp|P62779|H4_PYCHE Histone H4 OS=Pycnopodia helianthoides PE=3 SV=2 1 98 5.0E-45
sp|P62781|H4_PSAMI Histone H4 OS=Psammechinus miliaris PE=1 SV=2 1 98 5.0E-45
sp|P62778|H4_PISOC Histone H4 OS=Pisaster ochraceus PE=3 SV=2 1 98 5.0E-45
sp|P62777|H4_PISBR Histone H4 OS=Pisaster brevispinus PE=3 SV=2 1 98 5.0E-45
sp|P62780|H4_PARLI Histone H4 OS=Paracentrotus lividus PE=3 SV=2 1 98 5.0E-45
sp|P62782|H4_LYTPI Histone H4 OS=Lytechinus pictus PE=3 SV=2 1 98 5.0E-45
sp|P62776|H4_HOLTU Histone H4 OS=Holothuria tubulosa PE=3 SV=2 1 98 5.0E-45
sp|P62784|H4_CAEEL Histone H4 OS=Caenorhabditis elegans GN=his-1 PE=1 SV=2 1 98 5.0E-45
sp|Q6ZXX3|H4_USTMA Histone H4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HHF1 PE=3 SV=4 1 98 7.0E-45
sp|P70081|H48_CHICK Histone H4 type VIII OS=Gallus gallus GN=H4-VIII PE=3 SV=3 1 98 8.0E-45
sp|P82888|H4_OLILU Histone H4 OS=Olisthodiscus luteus PE=1 SV=2 1 98 1.0E-44
sp|Q8MTV8|H4_APLCA Histone H4 OS=Aplysia californica GN=His.H4 PE=3 SV=3 1 98 1.0E-44
sp|Q43083|H4_PYRSA Histone H4 OS=Pyrenomonas salina PE=3 SV=3 1 98 1.0E-44
sp|P27996|H4_SOLST Histone H4 OS=Solaster stimpsoni PE=3 SV=2 1 98 1.0E-44
sp|P91882|H4_DIAPU Histone H4 OS=Diadromus pulchellus PE=3 SV=3 11 98 1.0E-44
sp|P50566|H4_CHLRE Histone H4 OS=Chlamydomonas reinhardtii GN=H4-I PE=3 SV=2 1 98 2.0E-44
sp|Q41811|H43_MAIZE Histone H4.3 OS=Zea mays GN=H4 PE=1 SV=3 1 98 3.0E-44
sp|P08436|H4_VOLCA Histone H4 OS=Volvox carteri GN=H4-I PE=3 SV=2 1 98 5.0E-44
sp|P09322|H4_SCHPO Histone H4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhf1 PE=1 SV=2 1 98 7.0E-44
sp|P83865|H4_LITVA Histone H4 OS=Litopenaeus vannamei PE=1 SV=2 11 93 9.0E-44
sp|Q27443|H4_ASCSU Histone H4 OS=Ascaris suum PE=3 SV=2 1 98 1.0E-43
sp|Q8J1L3|H4_BLAAD Histone H4 OS=Blastobotrys adeninivorans GN=ahsb4 PE=3 SV=3 1 98 2.0E-43
sp|P23751|H42_EMENI Histone H4.2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfB PE=3 SV=2 1 98 2.0E-43
sp|P02309|H4_YEAST Histone H4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HHF1 PE=1 SV=2 1 98 2.0E-43
sp|Q8T7J8|H4_EIMTE Histone H4 OS=Eimeria tenella PE=3 SV=3 1 98 2.0E-43
sp|P04915|H4_PHYPO Histone H4 OS=Physarum polycephalum GN=H41 PE=3 SV=2 1 98 2.0E-43
sp|Q8NIQ8|H42_TALFU Histone H4.2 OS=Talaromyces funiculosus GN=H4.2 PE=3 SV=3 11 98 3.0E-43
sp|Q76MU7|H4_ASPOR Histone H4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhfA PE=3 SV=3 1 98 4.0E-43
sp|P23750|H41_EMENI Histone H4.1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfA PE=3 SV=2 1 98 4.0E-43
sp|P91890|H4_TRICD Histone H4 OS=Trichogramma cacoeciae PE=3 SV=3 11 98 5.0E-43
sp|P04914|H4_NEUCR Histone H4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH4-1 PE=3 SV=2 11 98 5.0E-43
sp|Q7LKT3|H4_ASPFU Histone H4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhfA PE=3 SV=3 11 98 5.0E-43
sp|Q711M0|H41_TALFU Histone H4.1 OS=Talaromyces funiculosus GN=H4.1 PE=3 SV=3 11 98 5.0E-43
sp|Q8NIG3|H4_CANGA Histone H4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HHF1 PE=3 SV=3 1 98 6.0E-43
sp|P91849|H4_APIME Histone H4 OS=Apis mellifera PE=3 SV=3 11 98 2.0E-42
sp|Q75AX1|H42_ASHGO Histone H4.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF2 PE=3 SV=4 1 98 2.0E-42
sp|Q757K0|H41_ASHGO Histone H4.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF1 PE=3 SV=3 1 98 2.0E-42
sp|P90516|H42_BLEJA Histone H4 (Fragment) OS=Blepharisma japonicum GN=H4 PE=3 SV=1 9 95 8.0E-42
sp|P80737|H41_BLEJA Histone H4-1 (Fragment) OS=Blepharisma japonicum PE=1 SV=3 18 95 2.0E-40
sp|P40287|H4_ENTHI Histone H4 OS=Entamoeba histolytica PE=3 SV=1 3 98 2.0E-38
sp|P80739|H4_EUPCR Histone H4 OS=Euplotes crassus PE=1 SV=3 18 98 9.0E-38
sp|Q76NW2|H4_DICDI Histone H4 OS=Dictyostelium discoideum GN=H4a PE=1 SV=1 16 98 3.0E-37
sp|P69152|H4_TETTS Histone H4 OS=Tetrahymena thermophila (strain SB210) GN=HHF1 PE=1 SV=2 18 98 5.0E-35
sp|P69151|H42_TETPY Histone H4, minor OS=Tetrahymena pyriformis PE=1 SV=2 18 98 5.0E-35
sp|P02310|H41_TETPY Histone H4, major OS=Tetrahymena pyriformis PE=1 SV=2 26 98 1.0E-34
sp|Q99525|H4G_HUMAN Histone H4-like protein type G OS=Homo sapiens GN=HIST1H4G PE=1 SV=1 1 98 3.0E-34
sp|Q8SQP4|H4_ENCCU Histone H4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HHF1 PE=3 SV=1 5 95 4.0E-16
sp|P80738|H4Y_BLEJA Histone H4 (Fragment) OS=Blepharisma japonicum PE=1 SV=2 18 45 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0090304 nucleic acid metabolic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094380
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTE
HAKRKTVTALDVVYALKRSGRVMIFIHRNFSAG*
Coding >AgabiH97|094380
ATGTCTGGACGCGGAAAAGGTGGCAAGGGCCTCGGAAAGGGTGGTGCCAAGCGTCACCGCAAGATTCTTCGTGAT
AACATCCAGGGTATCACCAAGCCGGCTATCCGTCGACTTGCCCGTCGTGGTGGTGTCAAACGTATCTCCGGTCTC
ATCTACGAGGAGACGCGTGGGGTTCTCAAGATTTTCCTTGAAAACGTTATTCGTGACTCTGTGACATACACCGAG
CACGCAAAGCGGAAGACAGTGACGGCGCTCGATGTTGTATACGCCCTGAAGCGCTCGGGCCGTGTAATGATATTT
ATTCACCGCAATTTCTCCGCTGGATAA
Transcript >AgabiH97|094380
ATGTCTGGACGCGGAAAAGGTGGCAAGGGCCTCGGAAAGGGTGGTGCCAAGCGTCACCGCAAGATTCTTCGTGAT
AACATCCAGGGTATCACCAAGCCGGCTATCCGTCGACTTGCCCGTCGTGGTGGTGTCAAACGTATCTCCGGTCTC
ATCTACGAGGAGACGCGTGGGGTTCTCAAGATTTTCCTTGAAAACGTTATTCGTGACTCTGTGACATACACCGAG
CACGCAAAGCGGAAGACAGTGACGGCGCTCGATGTTGTATACGCCCTGAAGCGCTCGGGCCGTGTAATGATATTT
ATTCACCGCAATTTCTCCGCTGGATAA
Gene >AgabiH97|094380
ATGTCTGGACGCGGAAAAGGTGGCAAGGGCCTCGGAAAGGGTGGTGCCAAGCGTCACCGCAAGATTCTTCGTGAT
AACATCCAGGGTATGGATTTCCGATGTTCGGCTGCCTCATGTGCTCATGGGTTTTGATAGGTATCACCAAGCCGG
CTATCCGTCGACTTGCCCGTCGTGGTGGTGTCAAACGTATCTCCGGTCTCATCTACGAGGAGACGCGTGGGGTTC
TCAAGATTTTCCTTGAAAACGTGAGTTGCTAAGATGGAAGATTGGAGCGTGGGCTCAGATCCTTTCTTCAGGTTA
TTCGTGACTCTGTGACATACACCGAGCACGCAAAGCGGAAGACAGTGACGGCGCTCGATGTTGTATACGCCCTGA
AGCGCTCGGGCCGTACGCTATATGGATTCGGTGCATAGATCTGCTGGGTTTTAGGTGTAATGATATTGTATTATA
AATTTTAATTTATTGTTGCGGTGGACCCGGCTGATCCCCCATTCCGACCCCAGTATTCACCGCAATTTCTCCGCT
GGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail