Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094360
Gene name
Locationscaffold_6:1577853..1579717
Strand-
Gene length (bp)1864
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.3E-68 97 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 9 421 1.0E-43
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 7 421 9.0E-41
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 95 420 2.0E-40
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 63 421 2.0E-38
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 95 421 6.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 9 421 1.0E-43
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 7 421 9.0E-41
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 95 420 2.0E-40
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 63 421 2.0E-38
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 95 421 6.0E-38
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 95 421 2.0E-37
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 61 421 4.0E-37
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 39 420 5.0E-37
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 11 423 5.0E-37
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 95 421 8.0E-37
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 95 421 9.0E-37
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 39 420 2.0E-36
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 77 421 2.0E-36
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 95 420 3.0E-36
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 63 421 3.0E-36
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 61 421 3.0E-36
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 95 420 3.0E-36
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 95 420 4.0E-36
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 61 420 4.0E-36
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 63 421 5.0E-36
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 37 420 5.0E-36
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 95 420 8.0E-36
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 95 420 9.0E-36
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 95 420 1.0E-35
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 38 420 1.0E-35
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 39 420 2.0E-35
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 85 421 3.0E-35
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 95 420 4.0E-35
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 35 420 4.0E-35
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 60 420 5.0E-35
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 63 421 6.0E-35
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 95 420 7.0E-35
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 86 420 9.0E-35
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 37 420 1.0E-34
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 95 420 2.0E-34
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 61 421 2.0E-34
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 39 420 2.0E-34
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 95 420 3.0E-34
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 95 420 4.0E-34
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 90 420 9.0E-34
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 95 421 2.0E-33
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 95 420 3.0E-33
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 9 421 3.0E-33
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 95 420 4.0E-33
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 92 459 4.0E-33
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 95 431 4.0E-33
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 20 420 6.0E-33
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 39 432 8.0E-33
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 95 420 1.0E-32
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 95 420 2.0E-32
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 77 424 2.0E-32
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 95 420 3.0E-32
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 5 420 4.0E-32
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 95 420 6.0E-32
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 39 420 7.0E-32
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 39 420 8.0E-32
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 95 420 1.0E-31
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 59 403 2.0E-31
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 95 420 2.0E-31
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 95 420 3.0E-31
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 85 420 3.0E-31
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 95 420 3.0E-31
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 95 420 9.0E-31
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 95 421 1.0E-30
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 63 420 1.0E-30
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 37 420 2.0E-30
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 95 421 2.0E-30
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 95 421 6.0E-30
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 95 420 7.0E-30
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 95 420 9.0E-30
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 95 420 1.0E-29
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 95 420 2.0E-29
sp|P00795|CATD_PIG Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 95 421 2.0E-29
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 95 420 2.0E-29
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 37 420 3.0E-29
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 95 420 3.0E-29
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 95 420 3.0E-29
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 11 432 5.0E-29
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 95 420 5.0E-29
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 39 420 7.0E-29
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 37 420 8.0E-29
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 37 420 8.0E-29
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 35 420 1.0E-28
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 74 426 2.0E-28
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 81 420 2.0E-28
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 91 458 3.0E-28
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 95 324 5.0E-28
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 95 420 5.0E-28
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 86 420 2.0E-27
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 91 458 2.0E-27
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 95 420 6.0E-27
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 95 410 1.0E-26
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 37 420 2.0E-26
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 95 423 2.0E-26
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 95 420 4.0E-26
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 35 324 5.0E-26
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 64 324 1.0E-25
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 95 419 5.0E-25
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 5 420 7.0E-25
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 5 420 7.0E-25
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 5 420 1.0E-24
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 82 324 1.0E-24
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 95 420 2.0E-24
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 95 328 3.0E-24
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 95 324 3.0E-24
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 64 321 5.0E-24
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 4 420 3.0E-23
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 29 321 5.0E-23
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 5 420 9.0E-23
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 5 420 9.0E-23
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 44 420 1.0E-22
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 44 420 1.0E-22
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 4 420 1.0E-22
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 11 428 3.0E-22
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 11 428 5.0E-22
sp|A2R3L3|PEPA_ASPNC Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 5 420 5.0E-22
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 95 423 6.0E-22
sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 75 328 6.0E-22
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 42 420 1.0E-21
sp|P17946|PEPA_ASPAW Aspartic protease pep1 OS=Aspergillus awamori GN=pep1 PE=1 SV=1 5 420 1.0E-21
sp|Q12567|PEPA_ASPPH Aspartic protease pep1 OS=Aspergillus phoenicis GN=pep1 PE=1 SV=1 5 420 2.0E-21
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 11 428 3.0E-21
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 102 424 3.0E-21
sp|P85137|CARDF_CYNCA Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 95 421 7.0E-21
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 14 420 1.0E-20
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 76 321 1.0E-20
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 97 428 2.0E-20
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 97 428 2.0E-20
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 97 428 2.0E-20
sp|P55325|PEPA_ASPNG Aspartic protease pep1 OS=Aspergillus niger GN=pep1 PE=1 SV=1 5 420 2.0E-20
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 19 420 2.0E-20
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 72 428 3.0E-20
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 77 420 5.0E-20
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 72 428 7.0E-20
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 95 420 9.0E-20
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 72 428 3.0E-19
sp|D4DGR1|Y6366_TRIVH Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 108 420 4.0E-19
sp|D4AT39|Y7403_ARTBC Probable aspartic-type endopeptidase ARB_07403 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07403 PE=3 SV=2 108 420 4.0E-19
sp|P11838|CARP_CRYPA Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 63 421 2.0E-18
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 7 424 3.0E-18
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 114 420 3.0E-18
sp|P46925|PLM2_PLAFA Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1 83 420 4.0E-18
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 95 420 7.0E-18
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 81 425 1.0E-17
sp|P85138|CARDG_CYNCA Cardosin-G (Fragments) OS=Cynara cardunculus PE=1 SV=1 95 421 1.0E-17
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 67 420 2.0E-17
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 81 425 2.0E-17
sp|P85139|CARDH_CYNCA Cardosin-H (Fragments) OS=Cynara cardunculus PE=1 SV=1 95 421 4.0E-17
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 1 424 2.0E-16
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 95 420 2.0E-16
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 79 426 2.0E-16
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 81 425 2.0E-16
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 62 420 2.0E-15
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 92 465 4.0E-15
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 97 428 4.0E-15
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 4 420 1.0E-14
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 98 420 1.0E-14
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 73 417 2.0E-14
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 72 428 5.0E-14
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 72 428 6.0E-14
sp|C5FW52|Y6955_ARTOC Probable aspartic-type endopeptidase MCYG_06955 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06955 PE=3 SV=1 52 420 8.0E-14
sp|D4ANC3|PEPA_ARTBC Aspartic protease PEP1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP1 PE=3 SV=1 4 420 2.0E-13
sp|D4D7C5|PEPA_TRIVH Aspartic endopeptidase PEP1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP1 PE=3 SV=1 4 420 4.0E-13
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 95 420 4.0E-13
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 12 420 4.0E-13
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 113 420 2.0E-12
sp|W8W138|BACE_STRPU Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 98 420 2.0E-12
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 97 428 6.0E-12
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 98 420 9.0E-12
sp|C5FBS2|PEPA_ARTOC Aspartic protease PEP1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP1 PE=3 SV=1 9 420 2.0E-11
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 98 420 6.0E-11
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 97 428 3.0E-10
sp|Q1KLR6|BACE1_CAVPO Beta-secretase 1 OS=Cavia porcellus GN=BACE1 PE=2 SV=1 72 320 4.0E-10
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 80 420 4.0E-10
sp|Q69IF8|PEPA_PHANO Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 14 421 5.0E-10
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 98 453 1.0E-09
sp|Q2HJ40|BACE1_BOVIN Beta-secretase 1 OS=Bos taurus GN=BACE1 PE=2 SV=1 74 320 2.0E-09
sp|Q6IE75|BACE2_RAT Beta-secretase 2 OS=Rattus norvegicus GN=Bace2 PE=2 SV=1 88 454 7.0E-09
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 97 420 1.0E-08
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 110 420 1.0E-08
sp|Q9JL18|BACE2_MOUSE Beta-secretase 2 OS=Mus musculus GN=Bace2 PE=2 SV=1 88 454 2.0E-08
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 98 459 2.0E-08
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 59 457 5.0E-08
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 124 441 4.0E-07
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 98 208 5.0E-06
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 98 208 6.0E-06
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 115 208 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 465 487 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 3.25 1.15 5.35
Initials Initials knots 0.91 0.24 1.57
Pileal_Stipeal_center Stage I stipe center 2.21 0.79 3.63
Pileal_Stipeal_shell Stage I stipe shell 5.47 2.48 8.46
DIF_stipe_center Stage II stipe center 3.39 1.45 5.34
DIF_stipe_shell Stage II stipe shell 2.21 0.81 3.60
DIF_stipe_skin Stage II stipe skin 2.49 0.93 4.05
DIF_cap_skin Stage II cap skin 8.36 4.09 12.63
DIF_cap_tissue Stage II cap tissue 10.91 5.48 16.34
DIF_gill_tissue Stage II gill tissue 8.44 4.14 12.73
YFB_stipe_center Young fruiting body stipe center 2.43 0.90 3.96
YFB_stipe_shell Young fruiting body stipe shell 1.80 0.59 3.00
YFB_stipe_skin Young fruiting body stipe skin 2.41 0.96 3.87
YFB_cap_skin Young fruiting body cap skin 12.61 6.46 18.75
YFB_cap_tissue Young fruiting body cap tissue 16.34 8.72 23.96
YFB_gill_tissue Young fruiting body gill tissue 5.64 2.53 8.76
YFB_veil Young fruiting body veil 5.58 2.53 8.64

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.016949 yes
Casing YFB_stipe_center 0.636520 no
Casing YFB_stipe_shell 0.233086 no
Casing YFB_stipe_skin 0.615697 no
Casing YFB_cap_skin 0.001140 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.205425 no
Casing YFB_veil 0.223939 no
Casing Initials 0.009123 yes
Casing Pileal_Stipeal_center 0.472318 no
Casing Pileal_Stipeal_shell 0.247152 no
Casing DIF_stipe_center 0.958374 no
Casing DIF_stipe_shell 0.485076 no
Casing DIF_stipe_skin 0.661676 no
Casing DIF_cap_skin 0.018344 yes
Casing DIF_cap_tissue 0.002084 yes
DIF_gill_tissue YFB_stipe_center 0.001140 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.298885 no
DIF_gill_tissue YFB_cap_tissue 0.040058 yes
DIF_gill_tissue YFB_gill_tissue 0.325060 no
DIF_gill_tissue YFB_veil 0.306815 no
YFB_stipe_center YFB_stipe_shell 0.628106 no
YFB_stipe_center YFB_stipe_skin 0.991369 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.030134 yes
YFB_stipe_center YFB_veil 0.033444 yes
YFB_stipe_shell YFB_stipe_skin 0.634790 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.002951 yes
YFB_stipe_shell YFB_veil 0.004160 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.023415 yes
YFB_stipe_skin YFB_veil 0.026955 yes
YFB_cap_skin YFB_cap_tissue 0.543011 no
YFB_cap_skin YFB_gill_tissue 0.015819 yes
YFB_cap_skin YFB_veil 0.014374 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.001140 yes
YFB_gill_tissue YFB_veil 0.987875 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.040723 yes
Initials YFB_stipe_shell 0.201033 no
Initials YFB_stipe_skin 0.041603 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.066584 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.004928 yes
Initials DIF_stipe_shell 0.070137 no
Initials DIF_stipe_skin 0.034604 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.905378 no
Pileal_Stipeal_center YFB_stipe_shell 0.766661 no
Pileal_Stipeal_center YFB_stipe_skin 0.910919 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.013186 yes
Pileal_Stipeal_center YFB_veil 0.015242 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.018066 yes
Pileal_Stipeal_center DIF_stipe_center 0.369030 no
Pileal_Stipeal_center DIF_stipe_shell 0.996856 no
Pileal_Stipeal_center DIF_stipe_skin 0.871648 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.278179 no
Pileal_Stipeal_shell YFB_stipe_center 0.037364 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.007439 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.030610 yes
Pileal_Stipeal_shell YFB_cap_skin 0.011041 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.001140 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.965601 no
Pileal_Stipeal_shell YFB_veil 0.978348 no
Pileal_Stipeal_shell DIF_stipe_center 0.256555 no
Pileal_Stipeal_shell DIF_stipe_shell 0.018896 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.038047 yes
Pileal_Stipeal_shell DIF_cap_skin 0.283656 no
Pileal_Stipeal_shell DIF_cap_tissue 0.047163 yes
DIF_stipe_center DIF_gill_tissue 0.006387 yes
DIF_stipe_center YFB_stipe_center 0.537751 no
DIF_stipe_center YFB_stipe_shell 0.161831 no
DIF_stipe_center YFB_stipe_skin 0.514500 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.217972 no
DIF_stipe_center YFB_veil 0.233528 no
DIF_stipe_center DIF_stipe_shell 0.386890 no
DIF_stipe_center DIF_stipe_skin 0.565575 no
DIF_stipe_center DIF_cap_skin 0.008457 yes
DIF_stipe_center DIF_cap_tissue 0.001140 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.905624 no
DIF_stipe_shell YFB_stipe_shell 0.768617 no
DIF_stipe_shell YFB_stipe_skin 0.911023 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.015242 yes
DIF_stipe_shell YFB_veil 0.017507 yes
DIF_stipe_shell DIF_stipe_skin 0.871271 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.001140 yes
DIF_stipe_skin YFB_stipe_center 0.979076 no
DIF_stipe_skin YFB_stipe_shell 0.586018 no
DIF_stipe_skin YFB_stipe_skin 0.970308 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.038942 yes
DIF_stipe_skin YFB_veil 0.042041 yes
DIF_stipe_skin DIF_cap_skin 0.001140 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.988583 no
DIF_cap_skin YFB_stipe_center 0.001140 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.275250 no
DIF_cap_skin YFB_cap_tissue 0.033906 yes
DIF_cap_skin YFB_gill_tissue 0.332804 no
DIF_cap_skin YFB_veil 0.312966 no
DIF_cap_skin DIF_cap_tissue 0.556082 no
DIF_cap_tissue DIF_gill_tissue 0.575602 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.793393 no
DIF_cap_tissue YFB_cap_tissue 0.272443 no
DIF_cap_tissue YFB_gill_tissue 0.060104 no
DIF_cap_tissue YFB_veil 0.055381 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094360
MPGKLSLTLAVLVALEATTLVSALPQSPKRRFNSSTRAVSLVRQPRTLKTAEEWGTWAYAHRRRMQAKYGGPVEG
KGELGRRSSGTNMMVNQGGDSSYYGTMSLGTPGTSFNVILDTGSSDLWVADSNCQAGCTSISTFQSSSSSTFQNL
STPFQITYGSGQAQGTLARDVVQMAGFAVPNQVFATCDLVSSGLLQNPVSGLMGLAFSTIASSGAIPFWQTLASG
GAWDSPVMGFYLTRFNNVTNAQKLEPGGSFDMGFTNTSLYQGDIDYVALPTKATYWILPLNSLSVNDSSISIPSG
SSSYAAIDTGTTLVGGPKSIIAHLFGQIPGSQPGTGNFEGYYTYPCNTPVIVRLGFGNSSQTWPISSDDFKLSEL
DQGQCLGAFFELSGGGSAPPWIIGDTFLKNVYSVFRYDPPSVGFANLSSTAISMNGVTGPVPSSTQGSTVATVSA
TGAPTTLSGDATSSTFGMMGAMTVVTTSLMAAMVGMLM*
Coding >AgabiH97|094360
ATGCCTGGAAAATTGTCACTTACGTTGGCTGTTTTGGTTGCTCTGGAAGCAACTACTCTCGTCTCCGCCTTACCG
CAATCACCGAAGCGACGTTTCAATTCCAGTACAAGGGCAGTTTCGTTAGTGCGTCAACCACGAACTTTGAAAACT
GCCGAAGAATGGGGTACTTGGGCATATGCTCATAGACGGAGAATGCAAGCGAAGTATGGTGGACCAGTGGAGGGT
AAAGGCGAGCTTGGAAGGAGAAGTAGCGGGACGAATATGATGGTCAATCAGGGAGGTGATTCTAGTTACTATGGA
ACAATGTCACTTGGAACGCCTGGTACTTCCTTCAATGTCATCCTTGACACTGGATCATCTGATCTTTGGGTGGCG
GACTCGAATTGTCAAGCCGGCTGCACTTCGATTTCGACTTTCCAATCTTCTTCCAGCAGCACGTTTCAAAACCTC
TCGACACCTTTCCAAATAACCTATGGGTCAGGTCAAGCACAAGGAACGTTGGCTCGGGATGTAGTTCAAATGGCC
GGTTTCGCCGTTCCTAACCAAGTGTTCGCCACTTGTGATCTTGTGTCCTCTGGTTTACTACAGAATCCTGTGTCG
GGGCTGATGGGTCTGGCTTTTTCAACGATTGCTTCGTCGGGTGCCATACCGTTTTGGCAGACTTTGGCGAGTGGA
GGTGCTTGGGATTCACCGGTGATGGGGTTTTACCTGACGAGGTTCAATAATGTTACGAACGCGCAAAAATTGGAG
CCTGGTGGATCTTTTGATATGGGATTCACGAATACGAGTTTGTATCAGGGAGATATCGATTATGTGGCGTTGCCG
ACAAAGGCCACATATTGGATACTTCCACTCAACTCACTGAGTGTCAATGATAGCTCTATTTCCATTCCGTCTGGG
TCTTCTTCCTATGCAGCCATCGACACAGGAACCACTCTTGTCGGTGGACCCAAATCGATCATCGCCCATCTCTTC
GGTCAGATTCCAGGTTCGCAGCCAGGTACAGGAAACTTCGAAGGGTACTACACTTATCCTTGCAACACACCTGTC
ATCGTTCGGCTTGGGTTCGGAAACTCGAGTCAGACGTGGCCGATTAGTTCTGACGATTTTAAGCTTTCGGAATTG
GACCAGGGTCAATGTTTGGGTGCATTCTTTGAACTCTCTGGTGGCGGATCTGCTCCACCTTGGATCATTGGAGAC
ACTTTTTTGAAAAACGTCTATTCAGTATTTCGTTACGACCCTCCCTCCGTAGGTTTCGCCAACCTTTCAAGTACG
GCTATAAGCATGAACGGAGTGACTGGACCCGTTCCCTCTTCAACACAAGGGTCTACAGTGGCGACTGTGTCCGCT
ACAGGAGCACCCACAACTTTGTCAGGCGACGCTACAAGTTCGACTTTTGGAATGATGGGTGCAATGACAGTTGTG
ACTACGTCGTTGATGGCTGCTATGGTAGGAATGCTTATGTAG
Transcript >AgabiH97|094360
ATGCCTGGAAAATTGTCACTTACGTTGGCTGTTTTGGTTGCTCTGGAAGCAACTACTCTCGTCTCCGCCTTACCG
CAATCACCGAAGCGACGTTTCAATTCCAGTACAAGGGCAGTTTCGTTAGTGCGTCAACCACGAACTTTGAAAACT
GCCGAAGAATGGGGTACTTGGGCATATGCTCATAGACGGAGAATGCAAGCGAAGTATGGTGGACCAGTGGAGGGT
AAAGGCGAGCTTGGAAGGAGAAGTAGCGGGACGAATATGATGGTCAATCAGGGAGGTGATTCTAGTTACTATGGA
ACAATGTCACTTGGAACGCCTGGTACTTCCTTCAATGTCATCCTTGACACTGGATCATCTGATCTTTGGGTGGCG
GACTCGAATTGTCAAGCCGGCTGCACTTCGATTTCGACTTTCCAATCTTCTTCCAGCAGCACGTTTCAAAACCTC
TCGACACCTTTCCAAATAACCTATGGGTCAGGTCAAGCACAAGGAACGTTGGCTCGGGATGTAGTTCAAATGGCC
GGTTTCGCCGTTCCTAACCAAGTGTTCGCCACTTGTGATCTTGTGTCCTCTGGTTTACTACAGAATCCTGTGTCG
GGGCTGATGGGTCTGGCTTTTTCAACGATTGCTTCGTCGGGTGCCATACCGTTTTGGCAGACTTTGGCGAGTGGA
GGTGCTTGGGATTCACCGGTGATGGGGTTTTACCTGACGAGGTTCAATAATGTTACGAACGCGCAAAAATTGGAG
CCTGGTGGATCTTTTGATATGGGATTCACGAATACGAGTTTGTATCAGGGAGATATCGATTATGTGGCGTTGCCG
ACAAAGGCCACATATTGGATACTTCCACTCAACTCACTGAGTGTCAATGATAGCTCTATTTCCATTCCGTCTGGG
TCTTCTTCCTATGCAGCCATCGACACAGGAACCACTCTTGTCGGTGGACCCAAATCGATCATCGCCCATCTCTTC
GGTCAGATTCCAGGTTCGCAGCCAGGTACAGGAAACTTCGAAGGGTACTACACTTATCCTTGCAACACACCTGTC
ATCGTTCGGCTTGGGTTCGGAAACTCGAGTCAGACGTGGCCGATTAGTTCTGACGATTTTAAGCTTTCGGAATTG
GACCAGGGTCAATGTTTGGGTGCATTCTTTGAACTCTCTGGTGGCGGATCTGCTCCACCTTGGATCATTGGAGAC
ACTTTTTTGAAAAACGTCTATTCAGTATTTCGTTACGACCCTCCCTCCGTAGGTTTCGCCAACCTTTCAAGTACG
GCTATAAGCATGAACGGAGTGACTGGACCCGTTCCCTCTTCAACACAAGGGTCTACAGTGGCGACTGTGTCCGCT
ACAGGAGCACCCACAACTTTGTCAGGCGACGCTACAAGTTCGACTTTTGGAATGATGGGTGCAATGACAGTTGTG
ACTACGTCGTTGATGGCTGCTATGGTAGGAATGCTTATGTAG
Gene >AgabiH97|094360
ATGCCTGGAAAATTGTCACTTACGTTGGCTGTTTTGGTTGCTCTGGAAGCAACTACTCTCGTCTCCGCCTTACCG
CAATCACCGAAGCGACGTTTCAATTCCAGTACAAGGGCAGTTTCGTTAGTGCGTCAACCACGAACTTTGAAAACT
GCCGAAGAATGGGGTACTTGGGCATATGCTCATAGACGGAGAATGCAAGCGAAGTATGGTGGACCAGTGGAGGGT
AAAGGCGAGCTTGGAAGGAGAAGTAGCGGGACGAATATGTGAGTTGATATTCTCCTTTACAAGGTGCTAGACTGA
TCGATTATTCATTCACCAGGATGGTCAATCAGGGAGGTGATTCTAGGTAAGAAATTTTGGCTTGCGGAGAATTTG
ATATTTATGGGAAAACAGTTACTATGGAACAATGTCACTTGGAACGCCTGGTACTTCCTTCAATGTCATCCTTGA
CACTGGATCATCGTACGTCACGAAATATTGTTCTCTCCTAGGGTTTGACGATTGACGTTTTCTTATAAGTGATCT
TTGGGTGGCGGACTCGAATTGTCAAGCCGGCTGCACTTCGATTTCGACTTTCCAATCTTCTTCCAGCAGCACGTT
TCAAAACCTCTCGACACCTTTCCAAATAACCTATGGGTCAGGTCAAGCACAAGGAACGTTGGCTCGGGATGTAGT
TCAAATGGCCGGTTTCGCCGTTCCTAACCAAGTGTTCGCCACTTGTGATCTTGTGTCCTCTGGTTTACTACAGAA
TCCTGTGTCGGGGCTGATGGGTCTGGCTTTTTCAACGATTGCTTCGTCGGGTGCCATACCGTTTTGGCAGACTTT
GGCGAGTGGAGGTGCTTGGGATTCACCGGTGATGGGGTTTTACCTGACGAGGTTCAATAATGTTACGAACGCGCA
AAAATTGGAGCCTGGTGGATCTTTTGATATGGGTGAGTGTGTGCTTTCAAGAACTTGAGAGGTCAAACTTAATCA
TCGGACTAGGATTCACGAATACGAGTTTGTATCAGGGAGATATCGATTATGTGGCGTTGCCGACAAAGGCCACAT
ATTGGATACTTCCACTCAACTGTTCGTCCTTCATCTCATATGCACACTCTTTTTATTTATACATTTTATTTTTAC
TAGCACTGAGTGTCAATGATAGCTCTATTTCCATTCCGTCTGGGTCTTCTTCCTATGCAGCCATCGACACAGGAA
CCACTCTTGTCGGTGGACCCAAATCGATCATCGCCCATCTCTTCGGTCAGATTCCAGGTTCGCAGCCAGGTACAG
GAAACTTCGAAGGGTACTACACTTATCGTCAGTTTCATTTTTGACTGATTGACGTTTTTATTGATAATGTCTTTT
GTTAGCTTGCAACACACCTGTCATCGTTCGGCTTGGGTTCGGAAACTCGAGTCAGACGTGGCCGATTAGTTCTGA
CGATTTTAAGCTTTCGGAATTGGACCAGGGTCAATGTTTGGGTGCATTCTTTGAACTCTCTGGTGGCGGATCTGC
TCCACCTTGGATCATTGGAGACACTTTTTTGGTGAGTTCTTTCTTTAACCGTCATACCATAAGACAGCCTCTCAT
CGATTCATTGCATTTCATTGCATTTCATTAGAAAAACGTCTATTCAGTATTTCGTTACGACCCTCCCTCCGTAGG
TTTCGCCAACCTTTCAAGTACGGCTATAAGCATGAACGGAGTGACTGGACCCGTTCCCTCTTCAACACAAGGGTC
TACAGTGGCGACTGTGTCCGCTACAGGAGCACCCACAACTTTGTCAGGCGACGCTACAAGTTCGACTTTTGGAAT
GATGGGTGCAATGACAGTTGTGACTACGTCGTTGATGGCTGCTATGGTAGGAATGCTTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail