Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094220
Gene name
Locationscaffold_6:1540699..1542721
Strand-
Gene length (bp)2022
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.8E-11 96 235
PF13976 gag_pre-integrs GAG-pre-integrase domain 2.0E-10 450 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 43 652 6.0E-49
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 175 658 3.0E-30
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 278 644 4.0E-15
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 278 644 4.0E-15
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 278 644 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 43 652 6.0E-49
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 175 658 3.0E-30
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 278 644 4.0E-15
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 278 644 4.0E-15
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 278 644 3.0E-14
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 336 644 3.0E-13
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 336 644 3.0E-13
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 336 644 3.0E-13
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 336 644 3.0E-13
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 336 644 3.0E-13
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 336 644 3.0E-13
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 336 644 3.0E-13
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 336 644 3.0E-13
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 336 644 3.0E-13
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 336 644 3.0E-13
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 336 644 4.0E-13
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 336 644 6.0E-13
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 336 644 8.0E-13
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 336 644 8.0E-13
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 336 644 8.0E-13
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 336 644 8.0E-13
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 336 644 8.0E-13
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 336 644 8.0E-13
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 336 644 9.0E-13
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 336 644 1.0E-12
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 336 644 1.0E-12
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 336 644 1.0E-12
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 336 644 1.0E-12
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 336 644 1.0E-12
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 336 644 1.0E-12
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 336 644 1.0E-12
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 278 644 1.0E-12
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 336 644 1.0E-12
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 336 644 1.0E-12
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 336 644 1.0E-12
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 336 644 1.0E-12
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 336 644 2.0E-12
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 336 644 2.0E-12
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 336 644 2.0E-12
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 336 644 2.0E-12
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 336 644 2.0E-12
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 336 644 2.0E-12
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 336 644 2.0E-12
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 336 644 2.0E-12
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 336 644 2.0E-12
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 336 644 3.0E-11
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 503 644 7.0E-10
sp|P93293|M300_ARATH Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana GN=AtMg00300 PE=4 SV=1 450 542 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094220
MLKKRRLLQQLQLFPNHLSCPPTSFTSPALISTPMASGLPTFAKLNEENYSTWSGEMEAWLRASGLWRLVSGRQK
APSTSSPVTQAEADALDAFEARLDKAAGWLYLMVEQEQRIHFSGIQDSPVKMWEALEAVHCQKRAGMRFNAYDDL
FSIRKLEEESLQSLINRVESSKRKIKELRPSSFTLEQLDDELASMALIRALPDGFSGFTSSLLLMDKLDKTTVHQ
AFVTEDLQRRKRAQDASGTSQALAARSGSQFATKTCDFCGREGHKFSECKTFERAKSRAQEDAQKPRTPSTQAPE
KAQRVTKFAGNASTPHPSPSPSPSTPLQLDADFQWLADTGATSHMTPHWHWFKSYTSHKIPIRLADNSIVYSSGV
GSVVFEPVVNGKVVRAVEMTRVLHVPALRSNLLSCLYLARNKGFNITISSQSIDFKHKGTILFTATIHSNNSAEL
DGSTVTSETAFSVSTLPVDLSLWHRRFIHHNYADVKSMISKDLVSGLKLESNSCPDSICEPCLAGKMHSLPFPSS
LNHNRSPLELVHSDLHGLLPVASHSGYKYWITFIDNSTRFRAVYLLKAKSEAFEAFKVYKSWAETQLGVKLRALQ
DDKGGEYMSNAFISFTELAGIERRHSTRNRPQQNGLAERANRTMGERITAMLSESLLE*
Coding >AgabiH97|094220
ATGCTTAAAAAACGACGTTTACTTCAACAACTACAACTCTTCCCCAATCATCTTTCCTGCCCTCCAACTTCTTTC
ACTTCCCCTGCCCTCATTTCGACTCCAATGGCCTCCGGATTGCCCACTTTCGCGAAACTCAACGAGGAAAACTAC
TCCACATGGTCTGGAGAGATGGAGGCGTGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAG
GCTCCCTCCACCTCTAGCCCTGTTACCCAGGCTGAAGCGGACGCTCTGGACGCATTTGAGGCTCGCTTGGACAAG
GCTGCAGGCTGGCTGTACCTTATGGTTGAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTG
AAGATGTGGGAGGCTCTAGAGGCTGTACATTGTCAGAAAAGGGCTGGAATGCGATTCAATGCCTATGATGACCTC
TTCTCCATCCGAAAACTCGAGGAGGAGTCACTCCAATCCCTTATCAACAGAGTGGAGAGCTCTAAACGAAAAATC
AAGGAACTCCGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCG
CTCCCGGACGGGTTTTCCGGCTTCACTTCGTCTCTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAG
GCCTTTGTCACTGAGGACTTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCTCTTGCAGCT
CGCTCTGGCTCCCAATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCTGAATGCAAA
ACCTTCGAGAGAGCGAAGTCCCGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCCTCGACTCAGGCTCCCGAA
AAAGCGCAGAGAGTCACCAAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCTTCACCCTCGCCTTCTACA
CCTCTCCAGCTCGATGCTGACTTCCAATGGCTAGCAGATACAGGGGCCACTTCTCATATGACCCCTCACTGGCAC
TGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCAATTGTCTATTCTTCGGGGGTG
GGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTCGAGATGACTAGAGTTCTGCATGTC
CCGGCTCTCCGGAGCAATCTACTATCATGTCTATACCTTGCCCGTAACAAGGGCTTCAATATCACCATCTCCTCT
CAATCCATTGACTTCAAACATAAGGGAACAATACTTTTCACGGCCACTATTCATTCTAACAACTCTGCTGAGCTC
GACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCGGTTGACCTCTCGCTATGGCATCGT
CGCTTTATTCATCACAACTACGCTGATGTAAAGTCTATGATCAGTAAGGATCTAGTTTCTGGGCTCAAACTCGAG
TCTAACTCATGTCCTGACTCTATCTGTGAGCCATGTCTAGCTGGCAAGATGCATTCCCTTCCTTTTCCCTCCTCT
TTGAATCACAATCGCTCCCCTCTCGAGCTGGTGCATTCAGATCTTCACGGACTGCTCCCAGTCGCTTCACACTCA
GGCTACAAGTACTGGATTACCTTCATCGACAACTCGACACGTTTTCGGGCAGTGTATCTGCTTAAAGCAAAGTCT
GAGGCATTTGAAGCCTTCAAAGTCTACAAATCCTGGGCTGAGACTCAACTCGGAGTCAAACTGCGAGCACTACAG
GATGACAAGGGAGGTGAATACATGTCTAATGCTTTCATAAGCTTTACTGAGCTTGCTGGCATCGAGAGACGTCAC
TCGACTCGGAACCGGCCTCAGCAGAATGGTCTTGCTGAACGGGCTAATAGGACTATGGGAGAGAGGATCACTGCT
ATGCTCTCGGAATCTCTGTTAGAGTGA
Transcript >AgabiH97|094220
ATGCTTAAAAAACGACGTTTACTTCAACAACTACAACTCTTCCCCAATCATCTTTCCTGCCCTCCAACTTCTTTC
ACTTCCCCTGCCCTCATTTCGACTCCAATGGCCTCCGGATTGCCCACTTTCGCGAAACTCAACGAGGAAAACTAC
TCCACATGGTCTGGAGAGATGGAGGCGTGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAG
GCTCCCTCCACCTCTAGCCCTGTTACCCAGGCTGAAGCGGACGCTCTGGACGCATTTGAGGCTCGCTTGGACAAG
GCTGCAGGCTGGCTGTACCTTATGGTTGAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTG
AAGATGTGGGAGGCTCTAGAGGCTGTACATTGTCAGAAAAGGGCTGGAATGCGATTCAATGCCTATGATGACCTC
TTCTCCATCCGAAAACTCGAGGAGGAGTCACTCCAATCCCTTATCAACAGAGTGGAGAGCTCTAAACGAAAAATC
AAGGAACTCCGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCG
CTCCCGGACGGGTTTTCCGGCTTCACTTCGTCTCTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAG
GCCTTTGTCACTGAGGACTTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCTCTTGCAGCT
CGCTCTGGCTCCCAATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCTGAATGCAAA
ACCTTCGAGAGAGCGAAGTCCCGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCCTCGACTCAGGCTCCCGAA
AAAGCGCAGAGAGTCACCAAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCTTCACCCTCGCCTTCTACA
CCTCTCCAGCTCGATGCTGACTTCCAATGGCTAGCAGATACAGGGGCCACTTCTCATATGACCCCTCACTGGCAC
TGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCAATTGTCTATTCTTCGGGGGTG
GGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTCGAGATGACTAGAGTTCTGCATGTC
CCGGCTCTCCGGAGCAATCTACTATCATGTCTATACCTTGCCCGTAACAAGGGCTTCAATATCACCATCTCCTCT
CAATCCATTGACTTCAAACATAAGGGAACAATACTTTTCACGGCCACTATTCATTCTAACAACTCTGCTGAGCTC
GACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCGGTTGACCTCTCGCTATGGCATCGT
CGCTTTATTCATCACAACTACGCTGATGTAAAGTCTATGATCAGTAAGGATCTAGTTTCTGGGCTCAAACTCGAG
TCTAACTCATGTCCTGACTCTATCTGTGAGCCATGTCTAGCTGGCAAGATGCATTCCCTTCCTTTTCCCTCCTCT
TTGAATCACAATCGCTCCCCTCTCGAGCTGGTGCATTCAGATCTTCACGGACTGCTCCCAGTCGCTTCACACTCA
GGCTACAAGTACTGGATTACCTTCATCGACAACTCGACACGTTTTCGGGCAGTGTATCTGCTTAAAGCAAAGTCT
GAGGCATTTGAAGCCTTCAAAGTCTACAAATCCTGGGCTGAGACTCAACTCGGAGTCAAACTGCGAGCACTACAG
GATGACAAGGGAGGTGAATACATGTCTAATGCTTTCATAAGCTTTACTGAGCTTGCTGGCATCGAGAGACGTCAC
TCGACTCGGAACCGGCCTCAGCAGAATGGTCTTGCTGAACGGGCTAATAGGACTATGGGAGAGAGGATCACTGCT
ATGCTCTCGGAATCTCTGTTAGAGTGA
Gene >AgabiH97|094220
ATGCTTAAAAAACGACGTTTACTTCAACAACTACAACTCTTCCCCAATCATCTTTCCTGCCCTCCAACTTCTTTC
ACTTCCCCTGCCCTCATTTCGACTCCAATGGCCTCCGGATTGCCCACTTTCGCGAAACTCAACGAGGAAAACTAC
TCCACATGGTCTGGAGAGATGGAGGCGTGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAG
GCTCCCTCCACCTCTAGCCCTGTTACCCAGGCTGAAGCGGACGCTCTGGACGCATTTGAGGCTCGCTTGGACAAG
GCTGCAGGCTGGCTGTACCTTATGGTTGAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTG
AAGATGTGGGAGGCTCTAGAGGCTGTACATTGTCAGAAAAGGGCTGGAATGCGATTCAATGCCTATGATGACCTC
TTCTCCATCCGAAAACTCGAGGAGGAGTCACTCCAATCCCTTATCAACAGAGTGGAGAGCTCTAAACGAAAAATC
AAGGAACTCCGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCG
CTCCCGGACGGGTTTTCCGGCTTCACTTCGTCTCTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAG
GCCTTTGTCACTGAGGACTTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCTCTTGCAGCT
CGCTCTGGCTCCCAATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCTGAATGCAAA
ACCTTCGAGAGAGCGAAGTCCCGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCGTAAAAGAGGGCTAACAAG
GCTCAGGAAGAGTCTGGGAGCTCTAGCTCGACTCAGGCTCCCGAAAAAGCGCAGAGAGTCACCAAGTTTGCTGGT
AATGCAAGTACCCCTCATCCCTCACCTTCACCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCAATGG
CTAGCAGATACAGGGGCCACTTCTCATATGACCCCTCACTGGCACTGGTTCAAGTCATATACCAGTCACAAAATC
CCCATCCGACTAGCTGACAACTCAATTGTCTATTCTTCGGGGGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAAT
GGAAAGGTGGTCAGAGCAGTCGAGATGACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTACTATCATGT
CTATACCTTGCCCGTAACAAGGGCTTCAATATCACCATCTCCTCTCAATCCATTGACTTCAAACATAAGGGAACA
ATACTTTTCACGGCCACTATTCATTCTAACAACTCTGCTGAGCTCGACGGCTCAACTGTGACTTCTGAGACTGCT
TTCTCTGTCTCTACCCTCCCGGTTGACCTCTCGCTATGGCATCGTCGCTTTATTCATCACAACTACGCTGATGTA
AAGTCTATGATCAGTAAGGATCTAGTTTCTGGGCTCAAACTCGAGTCTAACTCATGTCCTGACTCTATCTGTGAG
CCATGTCTAGCTGGCAAGATGCATTCCCTTCCTTTTCCCTCCTCTTTGAATCACAATCGCTCCCCTCTCGAGCTG
GTGCATTCAGATCTTCACGGACTGCTCCCAGTCGCTTCACACTCAGGCTACAAGTACTGGATTACCTTCATCGAC
AACTCGACACGTTTTCGGGCAGTGTATCTGCTTAAAGCAAAGTCTGAGGCATTTGAAGCCTTCAAAGTCTACAAA
TCCTGGGCTGAGACTCAACTCGGAGTCAAACTGCGAGCACTACAGGATGACAAGGGAGGTGAATACATGTCTAAT
GCTTTCATAAGCTTTACTGAGCTTGCTGGCATCGAGAGACGTCACTCGACTCGGAACCGGCCTCAGCAGAATGGT
CTTGCTGAACGGGCTAATAGGACTATGGGAGAGAGGATCACTGCTATGCTCTCGGAATCTCTGTTAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail