Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|094020
Gene name
Locationscaffold_6:1496839..1499825
Strand-
Gene length (bp)2986
Transcript length (bp)2832
Coding sequence length (bp)2832
Protein length (aa) 944

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 2.2E-10 738 841
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 2.9E-08 709 807
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 6.7E-08 121 207
PF13650 Asp_protease_2 Aspartyl protease 3.0E-07 120 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 456 865 9.0E-22
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 456 865 9.0E-22
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 456 865 9.0E-22
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 456 865 9.0E-22
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 456 865 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 456 865 9.0E-22
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 456 865 9.0E-22
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 456 865 9.0E-22
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 456 865 9.0E-22
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 456 865 1.0E-21
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 456 865 1.0E-21
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 456 865 1.0E-21
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 456 865 1.0E-21
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 456 865 1.0E-20
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 456 865 1.0E-20
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 456 865 1.0E-20
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 445 866 4.0E-20
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 466 865 3.0E-19
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 466 865 1.0E-18
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 452 865 2.0E-16
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 472 860 3.0E-14
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 444 865 4.0E-13
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 472 860 3.0E-12
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 472 860 3.0E-12
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 472 860 3.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 472 746 4.0E-12
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 456 865 5.0E-12
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 472 860 8.0E-12
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 472 860 1.0E-11
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 472 746 1.0E-11
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 472 746 1.0E-11
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 472 746 2.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 472 860 2.0E-11
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 456 865 6.0E-10
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 482 865 9.0E-10
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 482 865 1.0E-09
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 472 709 4.0E-09
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 445 848 4.0E-09
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 445 848 1.0E-06
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 447 842 1.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6422 0.5169 0.5072 0.2438 0.1508 0.0551 0.1065 0.0923 0.0294 0.0158

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup84
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|094020
Agaricus bisporus var bisporus H39 AgabiH39|094110
Agaricus bisporus var bisporus H39 AgabiH39|221700
Agaricus bisporus var bisporus H39 AgabiH39|383500
Agaricus bisporus var bisporus H39 AgabiH39|492200
Agaricus bisporus var bisporus H97 AgabiH97|024000
Agaricus bisporus var bisporus H97 AgabiH97|094020 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|1689_1
Rhodonia placenta FPRL280 RhoplFPRL280|1661_1
Rhodonia placenta FPRL280 RhoplFPRL280|1562_2
Rhodonia placenta FPRL280 RhoplFPRL280|1546_1
Rhodonia placenta FPRL280 RhoplFPRL280|1518_1
Rhodonia placenta FPRL280 RhoplFPRL280|1486_1
Rhodonia placenta FPRL280 RhoplFPRL280|1254_2
Rhodonia placenta FPRL280 RhoplFPRL280|1310_2
Rhodonia placenta FPRL280 RhoplFPRL280|1268_1
Rhodonia placenta FPRL280 RhoplFPRL280|1805_1
Rhodonia placenta FPRL280 RhoplFPRL280|1185_2
Rhodonia placenta FPRL280 RhoplFPRL280|1155_1
Rhodonia placenta FPRL280 RhoplFPRL280|1134_2
Rhodonia placenta FPRL280 RhoplFPRL280|1387_2
Rhodonia placenta FPRL280 RhoplFPRL280|972_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|094020
MAPKLREMWKEVISKRRVPVNHIEDIGEETAKENDEDNTSSSQAMTETWDVVALDTLESPKKIQQLAKDAQGQYI
QTWRIDDPIMQYLSTMTLGDREKQVFSITNKDIIAAKGMENLRVIPAIINGVREEEALLDSGSQIVSMSRTAASE
SKLSWDPQLSINMMAANGQVTRTCGVARNVPFTLGNITVHLQVHVLEGAAYRVLLGRPFDVITESKILNSQEGKQ
YINLTDPSTKEQAMLSTYARGPWLEGEAACIISTDENTENPYISEVLPIQAKQFEQDELNLLYLKRSLEEGEQPE
KAIISQYLQYAAQSYCPGQPITAVEPLDNQSDPALVLAKKYKPVALKVKPVLGELPDKFRILRHITGDPLAEMPQ
LPVKPKDFEPKGRYTQEQKEKLDSTHSGDFLWPEERKLMHWMIAEQNGAFAWEDSERGSFKEEYFPAVEIPTVAH
TPWVEKHFRIPPAIYEEVCKIIKRKIDTGVYEPSNSSYRSKWFCVVKKDGKSLRLVHSLEPLNRVTIAHSGLPPA
TEELAMHFAGRACNGILDLWVGYDNRKLATVSRDLTTFQSPFGALRLVTLPMGWTNSVPIFHEDVTYILRDEVLE
YTLPYIDDVPIRGPRSRYELEGSVDSYEVLKENSGIRRFIYEHFQTVNRILQRMNDTIGKILRWGDCMDTTDVRA
FLGTAVQCRNHIPHFVTLASPLYNICKKGVPFEWGPKQITAQQRLKDSIAMCLHTRNPKFPSSEPLVLAVDSSWR
GVGYYLYQRDENDQKLVHYVKFNSILMDERQQRYSQPKRELCGLRMALEEEIYLLRGCRNLVVETDAKYLFGMLN
NPGKLPNATVNRWVDYIRTHFHFTLLHKKGKSFGPDGLSRRKWYPGDPLARRFDDGSEDGEEDFELVKENPDDED
PLPLEAFVDEIDNQTGYLQQIINDTPVYQLARVATEQEIQQRA*
Coding >AgabiH97|094020
ATGGCACCAAAACTCAGGGAAATGTGGAAAGAAGTCATCAGCAAAAGAAGAGTGCCGGTTAATCATATAGAAGAC
ATCGGTGAGGAGACAGCTAAGGAAAACGACGAAGACAACACCAGTTCCAGTCAAGCTATGACAGAAACTTGGGAC
GTTGTAGCTTTGGACACCTTAGAATCTCCGAAAAAGATTCAGCAGTTAGCTAAAGATGCTCAAGGTCAATACATA
CAGACGTGGCGCATTGATGATCCTATCATGCAGTATCTGTCGACAATGACATTAGGTGACAGAGAGAAACAAGTT
TTCTCCATTACCAACAAGGATATCATTGCAGCTAAAGGAATGGAAAACCTACGAGTGATCCCAGCTATTATAAAT
GGAGTCCGAGAAGAAGAAGCACTTTTAGACAGCGGTTCACAGATAGTTTCAATGTCTAGAACAGCAGCTAGCGAG
TCTAAGCTCTCTTGGGACCCACAGCTAAGCATAAATATGATGGCAGCTAATGGACAAGTAACGCGAACCTGCGGA
GTAGCTAGGAATGTACCCTTCACATTAGGGAACATAACAGTTCATCTCCAAGTTCATGTACTCGAAGGAGCAGCT
TATAGAGTTCTCCTAGGTCGTCCATTCGATGTTATCACAGAAAGCAAGATCCTTAACTCACAAGAAGGAAAGCAG
TACATAAATCTGACTGATCCTAGTACCAAGGAGCAAGCTATGTTATCTACATATGCTCGGGGGCCTTGGCTCGAA
GGAGAAGCAGCTTGTATAATCAGCACAGACGAAAACACAGAGAATCCATATATCAGCGAAGTTCTGCCTATTCAA
GCTAAGCAATTCGAACAAGACGAGCTAAACTTGCTCTATTTGAAGCGTAGCTTAGAAGAAGGAGAACAGCCTGAG
AAGGCAATAATATCACAGTATCTACAGTATGCAGCGCAAAGCTATTGTCCAGGGCAACCTATCACAGCGGTTGAG
CCCTTAGACAATCAGTCAGATCCAGCATTAGTTCTAGCTAAGAAGTATAAACCAGTCGCTTTGAAAGTCAAGCCT
GTCTTGGGAGAGCTACCAGATAAGTTTCGCATTTTGAGACATATCACGGGAGACCCCTTGGCGGAGATGCCTCAG
CTACCTGTAAAACCTAAGGATTTCGAACCTAAGGGAAGATATACACAGGAGCAAAAGGAAAAGCTAGACTCAACG
CACTCAGGAGACTTCTTATGGCCTGAAGAACGAAAGCTAATGCATTGGATGATTGCAGAACAGAATGGAGCTTTC
GCTTGGGAAGACAGTGAAAGAGGAAGCTTCAAAGAAGAATACTTCCCAGCAGTAGAAATACCTACAGTAGCTCAT
ACCCCTTGGGTTGAGAAGCACTTCAGAATACCTCCAGCTATCTACGAAGAAGTCTGCAAGATCATTAAGAGGAAA
ATAGACACAGGTGTATACGAGCCGTCTAATTCATCTTATCGATCTAAGTGGTTCTGCGTAGTCAAGAAGGATGGT
AAAAGCTTACGGCTAGTCCATAGCTTAGAGCCTCTGAATCGCGTAACTATTGCGCATTCTGGGCTTCCTCCAGCA
ACAGAAGAATTAGCTATGCACTTCGCAGGCAGAGCTTGTAACGGAATCTTGGACTTATGGGTCGGCTACGACAAT
CGTAAGCTAGCTACAGTATCCAGAGACCTTACAACATTTCAGTCACCCTTTGGGGCACTCAGACTAGTAACACTA
CCTATGGGATGGACCAACTCGGTACCTATATTTCATGAGGATGTTACTTATATTCTTAGAGACGAAGTCCTAGAG
TATACATTGCCATATATAGATGATGTACCCATCAGAGGCCCACGCTCTCGCTACGAGCTAGAGGGATCGGTGGAT
AGCTACGAAGTTCTGAAAGAGAACTCGGGCATTCGTCGTTTTATATATGAGCACTTTCAGACAGTCAACAGAATC
TTACAGCGAATGAACGATACCATTGGGAAGATACTACGATGGGGTGACTGTATGGACACCACCGACGTCAGAGCT
TTCCTAGGAACAGCTGTTCAGTGTAGGAACCATATTCCGCACTTTGTAACGTTAGCTTCCCCTCTGTACAACATC
TGTAAGAAAGGCGTACCCTTTGAATGGGGTCCCAAACAGATTACAGCACAACAGCGCTTGAAGGACAGCATAGCT
ATGTGCCTTCATACCAGAAATCCTAAGTTCCCCAGTAGCGAACCGTTAGTTCTTGCGGTTGACTCTAGCTGGAGA
GGAGTAGGATACTACTTATATCAGCGAGACGAAAACGATCAGAAGCTAGTCCATTATGTGAAATTCAATTCGATC
TTAATGGATGAGAGACAGCAAAGGTATTCTCAACCAAAGCGAGAGCTATGTGGCTTGAGAATGGCCTTAGAAGAA
GAGATATACCTGTTGAGGGGATGCCGAAACTTAGTGGTAGAAACTGACGCTAAGTATCTCTTTGGGATGTTAAAC
AATCCTGGAAAGCTACCAAATGCGACGGTGAATCGCTGGGTGGACTACATCAGAACCCACTTCCATTTTACGCTT
CTACACAAGAAAGGAAAAAGCTTTGGGCCAGATGGCCTATCGCGACGTAAATGGTACCCAGGGGATCCCTTAGCT
AGACGATTTGATGATGGCTCCGAGGATGGAGAAGAGGACTTTGAACTAGTCAAGGAAAATCCTGACGATGAAGAT
CCTCTTCCTCTTGAAGCTTTTGTCGATGAAATCGATAATCAAACAGGTTATCTTCAACAGATAATAAATGATACT
CCTGTCTATCAACTGGCAAGGGTAGCTACAGAACAAGAAATACAGCAGCGAGCTTGA
Transcript >AgabiH97|094020
ATGGCACCAAAACTCAGGGAAATGTGGAAAGAAGTCATCAGCAAAAGAAGAGTGCCGGTTAATCATATAGAAGAC
ATCGGTGAGGAGACAGCTAAGGAAAACGACGAAGACAACACCAGTTCCAGTCAAGCTATGACAGAAACTTGGGAC
GTTGTAGCTTTGGACACCTTAGAATCTCCGAAAAAGATTCAGCAGTTAGCTAAAGATGCTCAAGGTCAATACATA
CAGACGTGGCGCATTGATGATCCTATCATGCAGTATCTGTCGACAATGACATTAGGTGACAGAGAGAAACAAGTT
TTCTCCATTACCAACAAGGATATCATTGCAGCTAAAGGAATGGAAAACCTACGAGTGATCCCAGCTATTATAAAT
GGAGTCCGAGAAGAAGAAGCACTTTTAGACAGCGGTTCACAGATAGTTTCAATGTCTAGAACAGCAGCTAGCGAG
TCTAAGCTCTCTTGGGACCCACAGCTAAGCATAAATATGATGGCAGCTAATGGACAAGTAACGCGAACCTGCGGA
GTAGCTAGGAATGTACCCTTCACATTAGGGAACATAACAGTTCATCTCCAAGTTCATGTACTCGAAGGAGCAGCT
TATAGAGTTCTCCTAGGTCGTCCATTCGATGTTATCACAGAAAGCAAGATCCTTAACTCACAAGAAGGAAAGCAG
TACATAAATCTGACTGATCCTAGTACCAAGGAGCAAGCTATGTTATCTACATATGCTCGGGGGCCTTGGCTCGAA
GGAGAAGCAGCTTGTATAATCAGCACAGACGAAAACACAGAGAATCCATATATCAGCGAAGTTCTGCCTATTCAA
GCTAAGCAATTCGAACAAGACGAGCTAAACTTGCTCTATTTGAAGCGTAGCTTAGAAGAAGGAGAACAGCCTGAG
AAGGCAATAATATCACAGTATCTACAGTATGCAGCGCAAAGCTATTGTCCAGGGCAACCTATCACAGCGGTTGAG
CCCTTAGACAATCAGTCAGATCCAGCATTAGTTCTAGCTAAGAAGTATAAACCAGTCGCTTTGAAAGTCAAGCCT
GTCTTGGGAGAGCTACCAGATAAGTTTCGCATTTTGAGACATATCACGGGAGACCCCTTGGCGGAGATGCCTCAG
CTACCTGTAAAACCTAAGGATTTCGAACCTAAGGGAAGATATACACAGGAGCAAAAGGAAAAGCTAGACTCAACG
CACTCAGGAGACTTCTTATGGCCTGAAGAACGAAAGCTAATGCATTGGATGATTGCAGAACAGAATGGAGCTTTC
GCTTGGGAAGACAGTGAAAGAGGAAGCTTCAAAGAAGAATACTTCCCAGCAGTAGAAATACCTACAGTAGCTCAT
ACCCCTTGGGTTGAGAAGCACTTCAGAATACCTCCAGCTATCTACGAAGAAGTCTGCAAGATCATTAAGAGGAAA
ATAGACACAGGTGTATACGAGCCGTCTAATTCATCTTATCGATCTAAGTGGTTCTGCGTAGTCAAGAAGGATGGT
AAAAGCTTACGGCTAGTCCATAGCTTAGAGCCTCTGAATCGCGTAACTATTGCGCATTCTGGGCTTCCTCCAGCA
ACAGAAGAATTAGCTATGCACTTCGCAGGCAGAGCTTGTAACGGAATCTTGGACTTATGGGTCGGCTACGACAAT
CGTAAGCTAGCTACAGTATCCAGAGACCTTACAACATTTCAGTCACCCTTTGGGGCACTCAGACTAGTAACACTA
CCTATGGGATGGACCAACTCGGTACCTATATTTCATGAGGATGTTACTTATATTCTTAGAGACGAAGTCCTAGAG
TATACATTGCCATATATAGATGATGTACCCATCAGAGGCCCACGCTCTCGCTACGAGCTAGAGGGATCGGTGGAT
AGCTACGAAGTTCTGAAAGAGAACTCGGGCATTCGTCGTTTTATATATGAGCACTTTCAGACAGTCAACAGAATC
TTACAGCGAATGAACGATACCATTGGGAAGATACTACGATGGGGTGACTGTATGGACACCACCGACGTCAGAGCT
TTCCTAGGAACAGCTGTTCAGTGTAGGAACCATATTCCGCACTTTGTAACGTTAGCTTCCCCTCTGTACAACATC
TGTAAGAAAGGCGTACCCTTTGAATGGGGTCCCAAACAGATTACAGCACAACAGCGCTTGAAGGACAGCATAGCT
ATGTGCCTTCATACCAGAAATCCTAAGTTCCCCAGTAGCGAACCGTTAGTTCTTGCGGTTGACTCTAGCTGGAGA
GGAGTAGGATACTACTTATATCAGCGAGACGAAAACGATCAGAAGCTAGTCCATTATGTGAAATTCAATTCGATC
TTAATGGATGAGAGACAGCAAAGGTATTCTCAACCAAAGCGAGAGCTATGTGGCTTGAGAATGGCCTTAGAAGAA
GAGATATACCTGTTGAGGGGATGCCGAAACTTAGTGGTAGAAACTGACGCTAAGTATCTCTTTGGGATGTTAAAC
AATCCTGGAAAGCTACCAAATGCGACGGTGAATCGCTGGGTGGACTACATCAGAACCCACTTCCATTTTACGCTT
CTACACAAGAAAGGAAAAAGCTTTGGGCCAGATGGCCTATCGCGACGTAAATGGTACCCAGGGGATCCCTTAGCT
AGACGATTTGATGATGGCTCCGAGGATGGAGAAGAGGACTTTGAACTAGTCAAGGAAAATCCTGACGATGAAGAT
CCTCTTCCTCTTGAAGCTTTTGTCGATGAAATCGATAATCAAACAGGTTATCTTCAACAGATAATAAATGATACT
CCTGTCTATCAACTGGCAAGGGTAGCTACAGAACAAGAAATACAGCAGCGAGCTTGA
Gene >AgabiH97|094020
ATGGCACCAAAACTCAGGGAAATGTGGAAAGAAGTCATCAGCAAAAGAAGAGTGCCGGTTAATCATATAGAAGAC
ATCGGTGAGGAGACAGCTAAGGAAAACGACGAAGACAACACCAGTTCCAGTCAAGCTATGACAGAAACTTGGGAC
GTTGTAGCTTTGGACACCTTAGAATCTCCGAAAAAGATTCAGCAGTTAGCTAAAGATGCTCAAGGTCAATACATA
CAGACGTGGCGCATTGATGATCCTATCATGCAGTATCTGTCGACAATGACATTAGGTGACAGAGAGAAACAAGTT
TTCTCCATTACCAACAAGGATATCATTGCAGCTAAAGGAATGGAAAACCTACGAGTGATCCCAGCTATTATAAAT
GGAGTCCGAGAAGAAGAAGCACTTTTAGACAGCGGTTCACAGATAGTTTCAATGTCTAGAACAGCAGCTAGCGAG
TCTAAGCTCTCTTGGGACCCACAGCTAAGCATAAATATGATGGCAGCTAATGGACAAGTAACGCGAACCTGCGGA
GTAGCTAGGAATGTACCCTTCACATTAGGGAACATAACAGTTCATCTCCAAGTTCATGTACTCGAAGGAGCAGCT
TATAGAGTTCTCCTAGGTCGTCCATTCGATGTTATCACAGAAAGCAAGATCCTTAACTCACAAGAAGGAAAGCAG
TACATAAATCTGACTGATCCTAGTACCAAGGAGCAAGCTATGTTATCTACATATGCTCGGGGTCAGTTACCAAAG
ACAGCAGACGTAAATTTTTAAGTAGCTTCGAGGAATTAGGGCCTTGGCTCGAAGGAGAAGCAGCTTGTATAATCA
GCACAGACGAAAACACAGAGAATCCATATATCAGCGAAGTTCTGCCTATTCAAGCTAAGCAATTCGAACAAGACG
AGCTAAACTTGCTCTATTTGAAGCGTAGCTTAGAAGAAGGAGAACAGCCTGAGAAGGCAATAATATCACAGTATC
TACAGTATGCAGCGCAAAGCTATTGTCCAGGGCAACCTATCACAGCGGTTGAGCCCTTAGACAATCAGTCAGATC
CAGCATTAGTTCTAGCTAAGAAGTATAAACCAGTCGCTTTGAAAGTCAAGCCTGTCTTGGGAGAGCTACCAGATA
AGTTTCGCATTTTGAGACATATCACGGGAGACCCCTTGGCGGAGATGCCTCAGCTACCTGTAAAACCTAAGGATT
TCGAACCTAAGGGAAGATATACACAGGAGCAAAAGGAAAAGCTAGACTCAACGCACTCAGGAGACTTCTTATGGC
CTGAAGAACGAAAGCTAATGCATTGGATGATTGCAGAACAGAATGGAGCTTTCGCTTGGGAAGACAGTGAAAGAG
GAAGCTTCAAAGAAGAATACTTCCCAGCAGTAGAAATACCTACAGTAGCTCATACCCCTTGGGTTGAGAAGCACT
TCAGAATACCTCCAGCTATCTACGAAGAAGTCTGCAAGATCATTAAGAGGAAAATAGACACAGGTGTATACGAGC
CGTCTAATTCATCTTATCGATCTAAGTGGTTCTGCGTAGTCAAGAAGGATGGTAAAAGCTTACGGCTAGTCCATA
GCTTAGAGCCTCTGAATCGCGTAACTATTGCGCATTCTGGGCTTCCTCCAGCAACAGAAGAATTAGCTATGCACT
TCGCAGGCAGAGCTTGTAACGGAATCTTGGACTTATGGGTCGGCTACGACAATCGTAAGCTAGCTACAGTATCCA
GAGACCTTACAACATTTCAGTCACCCTTTGGGGCACTCAGACTAGTAACACTACCTATGGGATGGACCAACTCGG
TACCTATATTTCATGAGGATGTTACTTATATTCTTAGAGACGAAGTCCTAGAGTATACATTGCCATATATAGATG
ATGTACCCATCAGAGGCCCACGCTCTCGCTACGAGCTAGAGGGATCGGTGGATAGCTACGAAGTTCTGAAAGAGA
ACTCGGGCATTCGTCGTTTTATATATGAGCACTTTCAGACAGTCAACAGAATCTTACAGCGAATGAAGTACGCAG
GAGGCACATTCTCAGGGCCTAAGACAACTATATGTGCAGACTATATCACTATAGTAGGTTTCGAGTGTAGCTATC
AAGGCCGAAACCTTCTAGCGATACCATTGGGAAGATACTACGATGGGGTGACTGTATGGACACCACCGACGTCAG
AGCTTTCCTAGGAACAGCTGTTCAGTGTAGGAACCATATTCCGCACTTTGTAACGTTAGCTTCCCCTCTGTACAA
CATCTGTAAGAAAGGCGTACCCTTTGAATGGGGTCCCAAACAGATTACAGCACAACAGCGCTTGAAGGACAGCAT
AGCTATGTGCCTTCATACCAGAAATCCTAAGTTCCCCAGTAGCGAACCGTTAGTTCTTGCGGTTGACTCTAGCTG
GAGAGGAGTAGGATACTACTTATATCAGCGAGACGAAAACGATCAGAAGCTAGTCCATTATGTGAAATTCAATTC
GATCTTAATGGATGAGAGACAGCAAAGGTATTCTCAACCAAAGCGAGAGCTATGTGGCTTGAGAATGGCCTTAGA
AGAAGAGATATACCTGTTGAGGGGATGCCGAAACTTAGTGGTAGAAACTGACGCTAAGTATCTCTTTGGGATGTT
AAACAATCCTGGAAAGCTACCAAATGCGACGGTGAATCGCTGGGTGGACTACATCAGAACCCACTTCCATTTTAC
GCTTCTACACAAGAAAGGAAAAAGCTTTGGGCCAGATGGCCTATCGCGACGTAAATGGTACCCAGGGGATCCCTT
AGCTAGACGATTTGATGATGGCTCCGAGGATGGAGAAGAGGACTTTGAACTAGTCAAGGAAAATCCTGACGATGA
AGATCCTCTTCCTCTTGAAGCTTTTGTCGATGAAATCGATAATCAAACAGGTTATCTTCAACAGATAATAAATGA
TACTCCTGTCTATCAACTGGCAAGGGTAGCTACAGAACAAGAAATACAGCAGCGAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail