© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|093640 |
| Gene name | |
| Location | scaffold_6:1395583..1396903 |
| Strand | + |
| Gene length (bp) | 1320 |
| Transcript length (bp) | 969 |
| Coding sequence length (bp) | 969 |
| Protein length (aa) | 323 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04045 | P34-Arc | Arp2/3 complex, 34 kD subunit p34-Arc | 1.8E-111 | 68 | 305 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14241|ARPC2_SCHPO | Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 | 19 | 320 | 6.0E-110 |
| sp|Q7PVX8|ARPC2_ANOGA | Probable actin-related protein 2/3 complex subunit 2 OS=Anopheles gambiae GN=Arc-p34 PE=3 SV=2 | 19 | 322 | 2.0E-94 |
| sp|Q9VIM5|ARPC2_DROME | Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster GN=Arpc2 PE=2 SV=2 | 19 | 319 | 4.0E-92 |
| sp|Q5R5Z5|ARPC2_PONAB | Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 | 19 | 322 | 2.0E-88 |
| sp|O15144|ARPC2_HUMAN | Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 | 19 | 322 | 2.0E-88 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14241|ARPC2_SCHPO | Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 | 19 | 320 | 6.0E-110 |
| sp|Q7PVX8|ARPC2_ANOGA | Probable actin-related protein 2/3 complex subunit 2 OS=Anopheles gambiae GN=Arc-p34 PE=3 SV=2 | 19 | 322 | 2.0E-94 |
| sp|Q9VIM5|ARPC2_DROME | Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster GN=Arpc2 PE=2 SV=2 | 19 | 319 | 4.0E-92 |
| sp|Q5R5Z5|ARPC2_PONAB | Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 | 19 | 322 | 2.0E-88 |
| sp|O15144|ARPC2_HUMAN | Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 | 19 | 322 | 2.0E-88 |
| sp|Q3MHR7|ARPC2_BOVIN | Actin-related protein 2/3 complex subunit 2 OS=Bos taurus GN=ARPC2 PE=1 SV=1 | 19 | 322 | 3.0E-88 |
| sp|Q9CVB6|ARPC2_MOUSE | Actin-related protein 2/3 complex subunit 2 OS=Mus musculus GN=Arpc2 PE=1 SV=3 | 19 | 322 | 8.0E-88 |
| sp|P85970|ARPC2_RAT | Actin-related protein 2/3 complex subunit 2 OS=Rattus norvegicus GN=Arpc2 PE=1 SV=1 | 19 | 319 | 1.0E-86 |
| sp|Q8WTM6|ARPC2_CAEEL | Probable actin-related protein 2/3 complex subunit 2 OS=Caenorhabditis elegans GN=arx-4 PE=3 SV=1 | 19 | 319 | 8.0E-83 |
| sp|P53731|ARPC2_YEAST | Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC35 PE=1 SV=1 | 19 | 321 | 1.0E-65 |
| sp|O96623|ARPC2_DICDI | Actin-related protein 2/3 complex subunit 2 OS=Dictyostelium discoideum GN=arcB PE=1 SV=1 | 19 | 317 | 2.0E-65 |
| sp|Q8LGI3|ARC2A_ARATH | Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana GN=ARPC2A PE=1 SV=1 | 19 | 303 | 3.0E-34 |
| sp|F4IVU1|ARC2B_ARATH | Actin-related protein 2/3 complex subunit 2B OS=Arabidopsis thaliana GN=ARPC2B PE=2 SV=1 | 19 | 305 | 1.0E-19 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0034314 | Arp2/3 complex-mediated actin nucleation | Yes |
| GO:0030833 | regulation of actin filament polymerization | Yes |
| GO:0015629 | actin cytoskeleton | Yes |
| GO:0005885 | Arp2/3 protein complex | Yes |
| GO:0008150 | biological_process | No |
| GO:0110053 | regulation of actin filament organization | No |
| GO:0044087 | regulation of cellular component biogenesis | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0005856 | cytoskeleton | No |
| GO:0043254 | regulation of protein-containing complex assembly | No |
| GO:0007015 | actin filament organization | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0005575 | cellular_component | No |
| GO:0032956 | regulation of actin cytoskeleton organization | No |
| GO:0065007 | biological regulation | No |
| GO:0090066 | regulation of anatomical structure size | No |
| GO:0032970 | regulation of actin filament-based process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0051493 | regulation of cytoskeleton organization | No |
| GO:0030832 | regulation of actin filament length | No |
| GO:0033043 | regulation of organelle organization | No |
| GO:0032535 | regulation of cellular component size | No |
| GO:0065008 | regulation of biological quality | No |
| GO:0016043 | cellular component organization | No |
| GO:0050789 | regulation of biological process | No |
| GO:0009987 | cellular process | No |
| GO:0008064 | regulation of actin polymerization or depolymerization | No |
| GO:0045010 | actin nucleation | No |
| GO:0032991 | protein-containing complex | No |
| GO:1902903 | regulation of supramolecular fiber organization | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0043226 | organelle | No |
| GO:0032271 | regulation of protein polymerization | No |
| GO:0097435 | supramolecular fiber organization | No |
| GO:0051128 | regulation of cellular component organization | No |
| GO:0043229 | intracellular organelle | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 304.88 | 177.06 | 432.71 |
| Initials | Initials knots | 198.03 | 117.72 | 278.34 |
| Pileal_Stipeal_center | Stage I stipe center | 148.10 | 89.15 | 207.06 |
| Pileal_Stipeal_shell | Stage I stipe shell | 136.61 | 82.39 | 190.83 |
| DIF_stipe_center | Stage II stipe center | 134.17 | 80.94 | 187.40 |
| DIF_stipe_shell | Stage II stipe shell | 165.06 | 98.47 | 231.64 |
| DIF_stipe_skin | Stage II stipe skin | 168.89 | 100.99 | 236.80 |
| DIF_cap_skin | Stage II cap skin | 136.44 | 82.18 | 190.70 |
| DIF_cap_tissue | Stage II cap tissue | 116.58 | 70.36 | 162.80 |
| DIF_gill_tissue | Stage II gill tissue | 106.68 | 64.29 | 149.07 |
| YFB_stipe_center | Young fruiting body stipe center | 183.97 | 109.31 | 258.63 |
| YFB_stipe_shell | Young fruiting body stipe shell | 202.39 | 120.67 | 284.11 |
| YFB_stipe_skin | Young fruiting body stipe skin | 192.74 | 115.16 | 270.31 |
| YFB_cap_skin | Young fruiting body cap skin | 196.70 | 117.32 | 276.08 |
| YFB_cap_tissue | Young fruiting body cap tissue | 123.90 | 74.35 | 173.45 |
| YFB_gill_tissue | Young fruiting body gill tissue | 178.36 | 105.68 | 251.03 |
| YFB_veil | Young fruiting body veil | 142.37 | 85.60 | 199.14 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.076086 | no |
| Casing | YFB_stipe_shell | 0.161568 | no |
| Casing | YFB_stipe_skin | 0.106032 | no |
| Casing | YFB_cap_skin | 0.127930 | no |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.051932 | no |
| Casing | YFB_veil | 0.002951 | yes |
| Casing | Initials | 0.134284 | no |
| Casing | Pileal_Stipeal_center | 0.005302 | yes |
| Casing | Pileal_Stipeal_shell | 0.002525 | yes |
| Casing | DIF_stipe_center | 0.001140 | yes |
| Casing | DIF_stipe_shell | 0.021846 | yes |
| Casing | DIF_stipe_skin | 0.023933 | yes |
| Casing | DIF_cap_skin | 0.001140 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.039836 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.009446 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.018066 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.013186 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.705237 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.051932 | no |
| DIF_gill_tissue | YFB_veil | 0.352603 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.841831 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.932700 | no |
| YFB_stipe_center | YFB_cap_skin | 0.898298 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.180324 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.956062 | no |
| YFB_stipe_center | YFB_veil | 0.450247 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.926914 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.958803 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.068461 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.772252 | no |
| YFB_stipe_shell | YFB_veil | 0.238649 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.969994 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.109152 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.875206 | no |
| YFB_stipe_skin | YFB_veil | 0.331092 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.095478 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.837911 | no |
| YFB_cap_skin | YFB_veil | 0.294143 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.220445 | no |
| YFB_cap_tissue | YFB_veil | 0.734755 | no |
| YFB_gill_tissue | YFB_veil | 0.526158 | no |
| Initials | DIF_gill_tissue | 0.014374 | yes |
| Initials | YFB_stipe_center | 0.883828 | no |
| Initials | YFB_stipe_shell | 0.968280 | no |
| Initials | YFB_stipe_skin | 0.960476 | no |
| Initials | YFB_cap_skin | 0.989627 | no |
| Initials | YFB_cap_tissue | 0.086247 | no |
| Initials | YFB_gill_tissue | 0.820852 | no |
| Initials | YFB_veil | 0.278986 | no |
| Initials | Pileal_Stipeal_center | 0.372922 | no |
| Initials | Pileal_Stipeal_shell | 0.210069 | no |
| Initials | DIF_stipe_center | 0.171265 | no |
| Initials | DIF_stipe_shell | 0.643684 | no |
| Initials | DIF_stipe_skin | 0.698231 | no |
| Initials | DIF_cap_skin | 0.203521 | no |
| Initials | DIF_cap_tissue | 0.047163 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.282311 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.558909 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.318419 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.436940 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.391271 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.640450 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.634621 | no |
| Pileal_Stipeal_center | YFB_veil | 0.940086 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.868986 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.829433 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.814082 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.762847 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.863718 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.485285 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.467485 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.375595 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.181451 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.265141 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.223716 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.830601 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.438425 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.937352 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.973278 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.626136 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.567553 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.998164 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.692078 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.505115 | no |
| DIF_stipe_center | YFB_stipe_center | 0.322431 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.145002 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.219408 | no |
| DIF_stipe_center | YFB_cap_skin | 0.182564 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.867614 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.383535 | no |
| DIF_stipe_center | YFB_veil | 0.906485 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.569594 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.511724 | no |
| DIF_stipe_center | DIF_cap_skin | 0.975421 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.728694 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.112109 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.816639 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.582543 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.707042 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.659401 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.366628 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.878157 | no |
| DIF_stipe_shell | YFB_veil | 0.720930 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.966023 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.611401 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.244377 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.103796 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.862635 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.639833 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.759269 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.713017 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.320070 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.917851 | no |
| DIF_stipe_skin | YFB_veil | 0.661113 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.551460 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.212706 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.466236 | no |
| DIF_cap_skin | YFB_stipe_center | 0.365009 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.170621 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.255267 | no |
| DIF_cap_skin | YFB_cap_skin | 0.214821 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.832182 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.425676 | no |
| DIF_cap_skin | YFB_veil | 0.934639 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.689117 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.850975 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.110389 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.039165 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.060104 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.049882 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.905219 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.136602 | no |
| DIF_cap_tissue | YFB_veil | 0.575999 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|093640 MYDGVCLFTRPQLHLLHAMILLEPHNTIIQTTLLDKIAKPSTLDVQFVDFDGVRFHLTSGDKKTMILLSMNIRCW DELARYGAVDILKREYGALVLDQPENEYNVSLMIDLEQVPQDPESRDAFVMSIAMLKRNALSATFERAFQEQKEL ETSGGKAELMEIHYRDEEAIYVQASPDRVTVIFSTIFREETDRIFGKVFLQEFVDARRQPSIQNAPQVLYTNRDP PLEIRHIAGLRSTEDTGYVTFVLFPRHFSKPDVAAATISHIQLFRDYLHYHIKCSKAYMHSRMRARVTEFQKVLN RAKAEVATGEKKTVSGRTMVHR* |
| Coding | >AgabiH97|093640 ATGTACGATGGTGTTTGTTTGTTCACTCGACCACAACTACATTTATTGCACGCGATGATTCTCCTGGAACCTCAT AACACGATCATTCAAACTACCCTCTTAGACAAGATCGCAAAGCCTTCGACCCTCGATGTCCAGTTCGTTGATTTC GATGGCGTACGCTTCCATTTAACATCGGGAGATAAGAAGACTATGATACTGCTGTCTATGAACATCCGATGTTGG GACGAACTGGCCAGATACGGTGCTGTGGATATTTTGAAACGAGAATACGGGGCGTTGGTGTTAGACCAACCTGAG AATGAGTATAATGTTAGCTTGATGATCGACTTGGAGCAAGTCCCGCAGGATCCTGAATCGCGGGATGCATTCGTA ATGTCGATTGCGATGTTAAAGAGAAATGCACTATCTGCAACTTTCGAGCGTGCATTCCAGGAACAGAAGGAGTTG GAGACGTCTGGAGGAAAGGCAGAACTGATGGAAATCCATTACCGGGACGAAGAAGCTATCTACGTCCAGGCTTCG CCCGACAGAGTTACCGTCATTTTCTCTACCATCTTCAGAGAGGAGACAGACCGCATCTTTGGCAAAGTGTTCTTG CAGGAATTCGTTGATGCTCGTAGGCAACCATCGATTCAGAATGCGCCTCAGGTTCTCTACACGAATCGCGATCCT CCCCTTGAAATTCGTCATATCGCAGGTCTGAGAAGTACTGAAGACACAGGCTATGTCACCTTTGTACTCTTTCCT CGGCATTTCTCAAAACCCGATGTGGCGGCTGCGACGATATCACACATCCAGTTGTTCCGTGATTATTTGCATTAT CACATCAAGTGTTCTAAGGCGTACATGCACTCTCGCATGCGGGCTCGGGTGACAGAATTCCAGAAAGTATTGAAT CGTGCCAAGGCAGAAGTGGCCACGGGTGAAAAGAAGACGGTTAGTGGGCGGACGATGGTCCATCGGTAG |
| Transcript | >AgabiH97|093640 ATGTACGATGGTGTTTGTTTGTTCACTCGACCACAACTACATTTATTGCACGCGATGATTCTCCTGGAACCTCAT AACACGATCATTCAAACTACCCTCTTAGACAAGATCGCAAAGCCTTCGACCCTCGATGTCCAGTTCGTTGATTTC GATGGCGTACGCTTCCATTTAACATCGGGAGATAAGAAGACTATGATACTGCTGTCTATGAACATCCGATGTTGG GACGAACTGGCCAGATACGGTGCTGTGGATATTTTGAAACGAGAATACGGGGCGTTGGTGTTAGACCAACCTGAG AATGAGTATAATGTTAGCTTGATGATCGACTTGGAGCAAGTCCCGCAGGATCCTGAATCGCGGGATGCATTCGTA ATGTCGATTGCGATGTTAAAGAGAAATGCACTATCTGCAACTTTCGAGCGTGCATTCCAGGAACAGAAGGAGTTG GAGACGTCTGGAGGAAAGGCAGAACTGATGGAAATCCATTACCGGGACGAAGAAGCTATCTACGTCCAGGCTTCG CCCGACAGAGTTACCGTCATTTTCTCTACCATCTTCAGAGAGGAGACAGACCGCATCTTTGGCAAAGTGTTCTTG CAGGAATTCGTTGATGCTCGTAGGCAACCATCGATTCAGAATGCGCCTCAGGTTCTCTACACGAATCGCGATCCT CCCCTTGAAATTCGTCATATCGCAGGTCTGAGAAGTACTGAAGACACAGGCTATGTCACCTTTGTACTCTTTCCT CGGCATTTCTCAAAACCCGATGTGGCGGCTGCGACGATATCACACATCCAGTTGTTCCGTGATTATTTGCATTAT CACATCAAGTGTTCTAAGGCGTACATGCACTCTCGCATGCGGGCTCGGGTGACAGAATTCCAGAAAGTATTGAAT CGTGCCAAGGCAGAAGTGGCCACGGGTGAAAAGAAGACGGTTAGTGGGCGGACGATGGTCCATCGGTAG |
| Gene | >AgabiH97|093640 ATGTACGATGGTGTTTGTTTGTTCACTCGACCACAACTACATTTATTGCACGGTATGTAGATTCAACCTACAAAG GGGACCGTTTCAGCTAAGACTTATCTGGCTCAGCGATGATTCTCCTGGAAGTAAGCCTGAGGTTGAAGCCCCTAA TAACCCTCACTTGGCTCATGGGATGTAATTTGCTTGCAGCCTCATAACACGATCATTCAAACTACCCTCTTAGAC AAGATCGCAAAGTTTGTCCATGGCGTGTTTACTCTTGTTCTGTCACTTCACAATATATGTCTAGGCCTTCGACCC TCGATGTCCAGTTCGTTGATTTCGATGGCGTACGCTTCCATTTAACATCGGGAGATAAGAAGACTATGATACTGC TGTCTATGAACATCCGATGTTGGGACGAACTGGCCAGATACGGTGCTGTGGATATTTTGAAACGAGAATACGGGG CGTTGGTGTTAGACCAACCTGAGAATGAGTATAATGTTAGCTTGATGATCGACTTGGAGCAAGTCCCGCAGGATC CTGGTGAGTTTAGACTCGATTAGATTATATTTGGGGAGCTGACAATGAACTATTCAGAATCGCGGGATGCATTCG TAATGTCGATTGCGATGTTAAAGAGAAATGCACTATCTGCAACTTTCGAGCGTGCATTCCAGGAACAGAAGGAGT TGGAGACGTCTGGAGGAAAGGCAGAACTGATGGAAATCCATTACCGGGACGAAGAAGCTATCTACGTCCAGGCTT CGCCCGACAGAGTTACCGTCATTTTCTCTACCATCTTCAGAGAGGAGACAGACCGCATCTTTGGCAAAGTGTTCT TGCAGGTGAATATGAATAAATGGTTTCCCTATATTACGGCGGCACTCGATTTCTGATGTTGAATCTGGATAGGAA TTCGTTGATGCTCGTAGGCAACCATCGATTCAGAATGCGCCTCAGGTTCTCTACACGAATCGCGATCCTCCCCTT GAAATTCGTCATATCGCAGGTCTGAGAAGTACTGAAGACACAGGCTATGTCACCTTTGTACTCTTTCCTCGGCAT TTCTCAAAACCCGATGTGGCGGCTGCGACGATATCACACATCCAGTTGTTCCGTGATTATTTGCATTATCACATC AAGTGTTCTAAGGCGTACATGCACTCTCGCATGCGGGCTCGGGTGACAGAATTCCAGAAAGTATTGAATCGTGCC AAGGCAGAAGTGGCCACGGGTGAAAAGAAGACGGTTAGGTGAGTGTCTATATTGACTCCTGGCGTCCAGCAGTAT CTGATTGATATTCGGTTTAGTGGGCGGACGATGGTCCATCGGTAG |