Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093610
Gene name
Locationscaffold_6:1385763..1387851
Strand+
Gene length (bp)2088
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 5.6E-03 478 500
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.4E-02 506 530
PF00096 zf-C2H2 Zinc finger, C2H2 type 8.1E-06 536 558
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.9E-06 564 588
PF13894 zf-C2H2_4 C2H2-type zinc finger 8.7E-05 536 558

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 412 575 1.0E-40
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 413 593 2.0E-36
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 413 593 3.0E-36
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 413 593 2.0E-35
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 413 593 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 412 575 1.0E-40
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 413 593 2.0E-36
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 413 593 3.0E-36
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 413 593 2.0E-35
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 413 593 2.0E-35
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 401 588 3.0E-35
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 413 593 5.0E-35
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 413 593 5.0E-35
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 413 593 5.0E-35
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 413 593 9.0E-35
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 406 588 1.0E-34
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 401 593 3.0E-34
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 451 593 4.0E-34
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 418 593 5.0E-34
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 418 593 6.0E-34
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 435 593 9.0E-34
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 396 593 9.0E-34
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 416 593 1.0E-33
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 393 593 1.0E-33
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 416 593 1.0E-33
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 406 593 1.0E-33
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 416 593 1.0E-33
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 418 593 2.0E-33
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 396 593 3.0E-33
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 394 593 3.0E-33
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 400 593 3.0E-33
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 397 593 5.0E-33
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 376 595 6.0E-33
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 418 593 6.0E-33
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 456 594 7.0E-33
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 456 594 7.0E-33
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 401 593 8.0E-33
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 396 593 8.0E-33
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 397 595 9.0E-33
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 430 595 1.0E-32
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 416 593 2.0E-32
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 418 593 2.0E-32
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 418 598 2.0E-32
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 396 593 2.0E-32
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 418 598 2.0E-32
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 457 588 2.0E-32
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 418 593 3.0E-32
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 379 593 3.0E-32
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 418 593 3.0E-32
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 416 593 3.0E-32
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 401 593 4.0E-32
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 418 593 5.0E-32
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 401 593 5.0E-32
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 409 593 5.0E-32
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 409 593 5.0E-32
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 392 593 5.0E-32
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 418 593 6.0E-32
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 418 593 6.0E-32
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 418 593 6.0E-32
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 409 593 6.0E-32
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 372 588 6.0E-32
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 401 588 7.0E-32
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 418 593 7.0E-32
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 418 598 7.0E-32
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 457 588 8.0E-32
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 396 593 8.0E-32
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 397 588 8.0E-32
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 401 593 8.0E-32
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 439 595 9.0E-32
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 396 593 9.0E-32
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 418 593 9.0E-32
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 439 595 1.0E-31
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 444 595 1.0E-31
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 444 595 1.0E-31
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 456 593 1.0E-31
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 401 593 1.0E-31
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 400 588 1.0E-31
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 418 593 1.0E-31
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 392 593 1.0E-31
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 397 588 1.0E-31
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 418 593 1.0E-31
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 418 595 1.0E-31
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 401 593 1.0E-31
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 401 593 1.0E-31
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 406 593 1.0E-31
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 401 588 1.0E-31
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 457 593 1.0E-31
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 398 591 1.0E-31
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 349 593 1.0E-31
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 391 593 2.0E-31
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 416 597 2.0E-31
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 392 593 2.0E-31
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 366 593 2.0E-31
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 400 593 2.0E-31
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 401 593 2.0E-31
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 418 593 2.0E-31
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 397 593 2.0E-31
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 457 593 2.0E-31
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 396 593 2.0E-31
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 416 595 2.0E-31
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 588 2.0E-31
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 418 595 2.0E-31
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 434 595 3.0E-31
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 440 595 3.0E-31
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 416 593 3.0E-31
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 418 593 3.0E-31
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 416 593 3.0E-31
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 401 593 3.0E-31
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 418 593 3.0E-31
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 418 593 3.0E-31
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 418 598 3.0E-31
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 454 593 3.0E-31
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 3.0E-31
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 416 593 3.0E-31
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 418 593 3.0E-31
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 457 593 3.0E-31
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 457 593 3.0E-31
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 404 591 4.0E-31
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 409 593 4.0E-31
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 418 593 4.0E-31
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 400 593 4.0E-31
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 400 593 4.0E-31
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 416 593 4.0E-31
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 401 595 5.0E-31
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 416 593 5.0E-31
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 416 593 5.0E-31
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 457 593 5.0E-31
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 401 593 5.0E-31
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 416 593 5.0E-31
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 457 590 6.0E-31
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 396 595 6.0E-31
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 456 593 6.0E-31
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 418 593 6.0E-31
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 418 593 6.0E-31
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 418 593 6.0E-31
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 394 593 6.0E-31
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 408 593 6.0E-31
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 418 593 6.0E-31
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 458 595 6.0E-31
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 418 588 7.0E-31
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 418 596 7.0E-31
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 416 593 7.0E-31
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 408 590 7.0E-31
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 416 593 7.0E-31
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 394 593 7.0E-31
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 401 595 8.0E-31
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 393 593 9.0E-31
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 357 593 9.0E-31
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 401 593 9.0E-31
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 391 593 9.0E-31
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 440 595 1.0E-30
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 393 593 1.0E-30
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 401 593 1.0E-30
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 418 591 1.0E-30
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 401 593 1.0E-30
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 401 593 1.0E-30
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 1.0E-30
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 408 588 1.0E-30
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 418 593 1.0E-30
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 338 593 1.0E-30
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 418 595 1.0E-30
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 418 593 1.0E-30
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 416 593 1.0E-30
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 457 593 1.0E-30
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 401 593 1.0E-30
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 408 590 1.0E-30
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 418 593 1.0E-30
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 411 593 2.0E-30
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 416 588 2.0E-30
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 418 593 2.0E-30
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 416 593 2.0E-30
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 456 593 2.0E-30
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 391 593 2.0E-30
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 401 588 2.0E-30
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 416 593 2.0E-30
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 416 593 2.0E-30
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 457 593 2.0E-30
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 408 588 2.0E-30
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 394 593 2.0E-30
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 337 591 2.0E-30
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 418 593 2.0E-30
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 388 588 2.0E-30
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 418 588 2.0E-30
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 457 593 2.0E-30
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 418 588 2.0E-30
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 413 593 2.0E-30
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 399 593 2.0E-30
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 457 593 2.0E-30
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 418 593 2.0E-30
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 456 594 2.0E-30
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 396 593 2.0E-30
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 396 593 2.0E-30
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 458 593 2.0E-30
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 418 593 2.0E-30
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 418 593 2.0E-30
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 421 593 2.0E-30
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 416 593 2.0E-30
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 418 595 2.0E-30
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 399 593 2.0E-30
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 418 593 2.0E-30
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 416 593 2.0E-30
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 418 588 3.0E-30
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 456 593 3.0E-30
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 418 591 3.0E-30
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 416 593 3.0E-30
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 593 3.0E-30
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 418 595 3.0E-30
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 588 3.0E-30
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 401 593 3.0E-30
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 418 593 3.0E-30
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 408 588 3.0E-30
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 418 593 3.0E-30
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 398 591 3.0E-30
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 401 588 3.0E-30
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 457 588 3.0E-30
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 401 594 3.0E-30
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 401 594 3.0E-30
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 457 592 3.0E-30
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 457 588 3.0E-30
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 330 593 3.0E-30
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 401 594 3.0E-30
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 401 593 3.0E-30
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 457 593 3.0E-30
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 418 593 3.0E-30
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 361 588 3.0E-30
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 392 593 3.0E-30
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 403 595 3.0E-30
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 434 595 4.0E-30
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 418 593 4.0E-30
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 400 593 4.0E-30
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 418 593 4.0E-30
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 456 588 4.0E-30
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 418 595 4.0E-30
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 400 588 4.0E-30
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 418 593 4.0E-30
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 396 593 4.0E-30
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 425 588 4.0E-30
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 401 593 4.0E-30
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 418 588 4.0E-30
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 401 593 4.0E-30
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 401 593 4.0E-30
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 408 588 4.0E-30
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 418 593 4.0E-30
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 408 588 4.0E-30
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 418 593 5.0E-30
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 401 588 5.0E-30
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 401 595 5.0E-30
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 457 593 5.0E-30
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 418 593 5.0E-30
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 5.0E-30
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 418 593 5.0E-30
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 457 591 5.0E-30
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 593 5.0E-30
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 418 593 5.0E-30
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 418 593 5.0E-30
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 418 593 5.0E-30
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 418 593 5.0E-30
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 418 593 5.0E-30
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 418 595 5.0E-30
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 393 588 5.0E-30
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 408 588 5.0E-30
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 408 593 5.0E-30
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 418 593 6.0E-30
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 416 593 6.0E-30
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 418 595 6.0E-30
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 418 588 6.0E-30
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 394 592 6.0E-30
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 456 589 6.0E-30
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 401 593 6.0E-30
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 416 593 6.0E-30
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 401 593 6.0E-30
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 418 593 6.0E-30
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 416 593 6.0E-30
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 401 598 6.0E-30
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 418 593 7.0E-30
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 457 591 7.0E-30
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 457 593 7.0E-30
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 401 593 7.0E-30
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 418 593 7.0E-30
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 434 593 7.0E-30
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 408 590 7.0E-30
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 416 593 8.0E-30
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 403 595 8.0E-30
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 401 593 8.0E-30
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 408 590 8.0E-30
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 396 593 9.0E-30
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 418 593 9.0E-30
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 418 593 9.0E-30
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 400 593 9.0E-30
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 418 593 9.0E-30
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 399 593 9.0E-30
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 339 593 9.0E-30
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 418 593 9.0E-30
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 401 588 9.0E-30
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 401 593 1.0E-29
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 418 588 1.0E-29
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 472 593 1.0E-29
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 416 593 1.0E-29
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 418 593 1.0E-29
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 401 593 1.0E-29
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 458 593 1.0E-29
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 377 593 1.0E-29
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 418 593 1.0E-29
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 418 593 1.0E-29
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 403 593 1.0E-29
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 418 593 1.0E-29
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 418 593 1.0E-29
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 416 593 1.0E-29
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 418 593 1.0E-29
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 418 593 1.0E-29
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 401 593 1.0E-29
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 418 593 1.0E-29
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 418 592 1.0E-29
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 396 593 1.0E-29
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 416 593 1.0E-29
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 418 593 1.0E-29
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 418 593 1.0E-29
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 418 593 1.0E-29
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 416 593 1.0E-29
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 418 593 1.0E-29
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 416 593 1.0E-29
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 457 588 1.0E-29
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 401 593 1.0E-29
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 457 593 1.0E-29
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 418 593 1.0E-29
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 418 590 1.0E-29
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 358 595 1.0E-29
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 403 588 1.0E-29
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 380 595 1.0E-29
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 438 593 1.0E-29
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 418 593 1.0E-29
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 418 593 1.0E-29
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 438 593 1.0E-29
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 416 593 1.0E-29
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 593 1.0E-29
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 457 588 1.0E-29
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 401 593 1.0E-29
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 416 593 1.0E-29
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 401 593 1.0E-29
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 398 593 1.0E-29
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 379 593 1.0E-29
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 418 591 1.0E-29
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 391 593 1.0E-29
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 418 593 1.0E-29
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 391 593 1.0E-29
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 418 591 1.0E-29
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 416 588 1.0E-29
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 418 595 2.0E-29
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 416 593 2.0E-29
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 401 593 2.0E-29
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 401 593 2.0E-29
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 418 588 2.0E-29
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 457 593 2.0E-29
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 416 593 2.0E-29
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 416 593 2.0E-29
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 418 593 2.0E-29
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 457 593 2.0E-29
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 457 588 2.0E-29
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 418 593 2.0E-29
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 418 589 2.0E-29
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 418 593 2.0E-29
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 418 593 2.0E-29
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 401 593 2.0E-29
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 418 593 2.0E-29
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 416 595 2.0E-29
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 418 593 2.0E-29
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 440 593 2.0E-29
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 418 593 2.0E-29
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 416 593 2.0E-29
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 418 591 2.0E-29
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 411 591 2.0E-29
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 395 593 2.0E-29
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 397 593 2.0E-29
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 378 595 2.0E-29
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 456 593 2.0E-29
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 457 588 2.0E-29
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 418 593 2.0E-29
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 418 593 2.0E-29
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 416 593 2.0E-29
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 418 584 2.0E-29
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 457 593 2.0E-29
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 457 588 2.0E-29
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 418 593 2.0E-29
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 433 593 2.0E-29
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 404 588 2.0E-29
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 391 593 2.0E-29
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 401 593 2.0E-29
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 418 593 2.0E-29
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 457 588 2.0E-29
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 418 593 2.0E-29
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 418 593 2.0E-29
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 457 594 2.0E-29
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 457 593 2.0E-29
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 418 591 2.0E-29
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 418 593 2.0E-29
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 418 588 2.0E-29
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 413 588 2.0E-29
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 418 593 2.0E-29
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 394 593 3.0E-29
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 427 593 3.0E-29
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 416 593 3.0E-29
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 397 593 3.0E-29
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 391 593 3.0E-29
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 370 593 3.0E-29
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 457 593 3.0E-29
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 424 593 3.0E-29
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 418 593 3.0E-29
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 400 593 3.0E-29
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 418 593 3.0E-29
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 401 595 3.0E-29
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 416 593 3.0E-29
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 418 593 3.0E-29
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 401 593 3.0E-29
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 409 593 3.0E-29
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 418 588 3.0E-29
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 431 588 3.0E-29
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 415 588 3.0E-29
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 403 593 3.0E-29
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 418 588 3.0E-29
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 396 593 3.0E-29
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 418 595 3.0E-29
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 338 593 3.0E-29
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 401 593 3.0E-29
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 418 597 3.0E-29
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 418 593 3.0E-29
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 400 588 3.0E-29
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 401 593 3.0E-29
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 401 593 3.0E-29
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 416 597 3.0E-29
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 416 593 3.0E-29
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 391 593 4.0E-29
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 394 588 4.0E-29
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 453 593 4.0E-29
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 418 593 4.0E-29
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 390 593 4.0E-29
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 401 595 4.0E-29
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 416 593 4.0E-29
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 396 593 4.0E-29
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 418 593 4.0E-29
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 401 593 4.0E-29
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 401 593 4.0E-29
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 403 595 4.0E-29
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 403 595 4.0E-29
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 418 593 4.0E-29
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 416 588 4.0E-29
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 418 593 4.0E-29
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 418 593 4.0E-29
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 416 593 4.0E-29
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 391 593 4.0E-29
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 416 593 4.0E-29
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 418 593 4.0E-29
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 418 588 4.0E-29
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 457 593 4.0E-29
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 411 593 4.0E-29
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 457 593 4.0E-29
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 418 593 4.0E-29
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 396 593 4.0E-29
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 416 594 4.0E-29
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 418 588 4.0E-29
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 429 593 4.0E-29
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 416 593 4.0E-29
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 369 591 4.0E-29
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 377 593 4.0E-29
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 318 593 5.0E-29
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 457 593 5.0E-29
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 401 593 5.0E-29
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 391 591 5.0E-29
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 401 593 5.0E-29
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 457 593 5.0E-29
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 312 595 5.0E-29
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 588 5.0E-29
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 394 593 5.0E-29
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 418 588 5.0E-29
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 400 593 5.0E-29
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 401 593 5.0E-29
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 459 593 5.0E-29
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 457 593 5.0E-29
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 457 593 5.0E-29
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 418 591 5.0E-29
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 457 593 5.0E-29
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 401 595 6.0E-29
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 418 593 6.0E-29
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 396 593 6.0E-29
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 401 593 6.0E-29
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 367 593 6.0E-29
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 401 588 6.0E-29
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 418 595 6.0E-29
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 401 593 6.0E-29
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 401 593 6.0E-29
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 457 591 6.0E-29
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 396 588 6.0E-29
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 418 591 6.0E-29
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 418 588 6.0E-29
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 457 593 6.0E-29
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 411 593 6.0E-29
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 418 593 6.0E-29
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 369 591 6.0E-29
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 429 593 6.0E-29
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 418 593 6.0E-29
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 416 593 6.0E-29
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 418 593 6.0E-29
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 416 593 7.0E-29
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 418 593 7.0E-29
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 457 593 7.0E-29
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 391 590 7.0E-29
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 384 593 7.0E-29
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 417 593 7.0E-29
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 392 593 7.0E-29
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 416 592 7.0E-29
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 416 592 7.0E-29
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 418 593 7.0E-29
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 434 593 7.0E-29
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 418 595 7.0E-29
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 457 591 7.0E-29
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 401 596 7.0E-29
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 457 593 7.0E-29
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 439 593 7.0E-29
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 391 593 8.0E-29
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 418 595 8.0E-29
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 418 593 8.0E-29
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 588 8.0E-29
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 418 593 8.0E-29
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 418 593 8.0E-29
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 593 8.0E-29
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 476 598 8.0E-29
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 593 8.0E-29
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 418 588 8.0E-29
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 395 593 8.0E-29
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 418 593 8.0E-29
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 418 593 9.0E-29
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 418 593 9.0E-29
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 401 588 9.0E-29
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 418 595 9.0E-29
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 418 593 9.0E-29
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 404 591 9.0E-29
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 418 588 9.0E-29
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 401 593 9.0E-29
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 403 588 9.0E-29
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 476 598 9.0E-29
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 396 591 9.0E-29
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 403 588 9.0E-29
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 418 593 1.0E-28
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 416 593 1.0E-28
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 457 588 1.0E-28
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 416 593 1.0E-28
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 396 593 1.0E-28
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 457 588 1.0E-28
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 418 593 1.0E-28
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 401 593 1.0E-28
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 450 595 1.0E-28
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 418 598 1.0E-28
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 429 593 1.0E-28
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 429 593 1.0E-28
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 418 588 1.0E-28
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 418 588 1.0E-28
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 393 593 1.0E-28
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 401 593 1.0E-28
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 396 593 1.0E-28
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 418 588 1.0E-28
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 401 593 1.0E-28
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 401 593 1.0E-28
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 401 593 1.0E-28
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 418 593 1.0E-28
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 416 593 1.0E-28
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 418 593 1.0E-28
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 418 588 1.0E-28
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 416 593 1.0E-28
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 593 1.0E-28
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 406 593 1.0E-28
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 423 593 1.0E-28
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 406 595 1.0E-28
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 418 588 1.0E-28
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 418 589 1.0E-28
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 423 593 1.0E-28
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 394 593 1.0E-28
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 437 588 1.0E-28
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 418 593 1.0E-28
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 391 593 1.0E-28
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 457 597 1.0E-28
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 403 588 1.0E-28
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 403 588 1.0E-28
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 403 588 1.0E-28
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 403 588 1.0E-28
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 401 593 1.0E-28
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 401 593 1.0E-28
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 418 588 1.0E-28
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 433 593 1.0E-28
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 401 593 1.0E-28
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 457 593 1.0E-28
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 418 593 1.0E-28
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 457 593 1.0E-28
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 401 593 2.0E-28
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 418 593 2.0E-28
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 418 588 2.0E-28
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 416 593 2.0E-28
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 457 588 2.0E-28
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 421 593 2.0E-28
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 418 575 2.0E-28
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 418 575 2.0E-28
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 418 593 2.0E-28
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 372 593 2.0E-28
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 418 598 2.0E-28
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 372 593 2.0E-28
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 372 593 2.0E-28
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 418 593 2.0E-28
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 418 588 2.0E-28
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 353 593 2.0E-28
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 398 595 2.0E-28
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 401 588 2.0E-28
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 395 595 2.0E-28
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 473 593 2.0E-28
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 459 593 2.0E-28
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 418 593 2.0E-28
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 418 593 2.0E-28
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 418 593 2.0E-28
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 302 593 2.0E-28
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 418 593 2.0E-28
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 396 593 2.0E-28
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 418 593 2.0E-28
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 400 588 2.0E-28
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 396 593 2.0E-28
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 396 593 2.0E-28
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 396 593 2.0E-28
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 418 595 2.0E-28
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 397 593 2.0E-28
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 2.0E-28
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 401 593 2.0E-28
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 415 593 2.0E-28
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 418 593 2.0E-28
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 401 593 2.0E-28
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 457 593 2.0E-28
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 401 593 2.0E-28
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 418 593 2.0E-28
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 418 593 2.0E-28
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 440 593 2.0E-28
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 418 588 2.0E-28
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 416 588 2.0E-28
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 418 593 2.0E-28
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 440 593 2.0E-28
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 396 593 2.0E-28
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 401 593 2.0E-28
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 418 588 2.0E-28
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 399 593 2.0E-28
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 418 595 2.0E-28
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 418 593 2.0E-28
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 439 593 2.0E-28
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 418 588 2.0E-28
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 396 593 2.0E-28
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 418 593 2.0E-28
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 418 593 2.0E-28
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 416 593 3.0E-28
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 418 588 3.0E-28
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 418 593 3.0E-28
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 421 593 3.0E-28
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 418 593 3.0E-28
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 401 593 3.0E-28
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 401 593 3.0E-28
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 401 593 3.0E-28
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 372 593 3.0E-28
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 401 593 3.0E-28
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 418 595 3.0E-28
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 379 597 3.0E-28
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 456 588 3.0E-28
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 456 588 3.0E-28
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 418 588 3.0E-28
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 418 593 3.0E-28
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 396 593 3.0E-28
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 401 593 3.0E-28
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 353 593 3.0E-28
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 416 592 3.0E-28
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 418 593 3.0E-28
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 396 588 3.0E-28
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 400 588 3.0E-28
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 457 593 3.0E-28
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 418 593 3.0E-28
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 396 588 3.0E-28
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 418 593 3.0E-28
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 418 593 3.0E-28
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 396 596 3.0E-28
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 379 588 3.0E-28
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 394 590 3.0E-28
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 401 593 3.0E-28
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 400 596 3.0E-28
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 457 593 3.0E-28
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 457 597 3.0E-28
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 372 592 3.0E-28
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 418 593 3.0E-28
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 400 598 3.0E-28
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 401 595 3.0E-28
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 418 593 3.0E-28
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 3.0E-28
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 378 598 3.0E-28
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 416 592 3.0E-28
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 418 593 4.0E-28
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 457 593 4.0E-28
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 418 593 4.0E-28
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 418 588 4.0E-28
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 401 593 4.0E-28
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 457 588 4.0E-28
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 456 593 4.0E-28
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 416 593 4.0E-28
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 418 593 4.0E-28
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 588 4.0E-28
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 418 593 4.0E-28
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 384 593 4.0E-28
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 418 593 4.0E-28
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 394 588 4.0E-28
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 402 593 4.0E-28
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 398 595 4.0E-28
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 457 588 4.0E-28
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 593 4.0E-28
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 418 593 4.0E-28
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 418 593 4.0E-28
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 418 593 4.0E-28
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 401 593 4.0E-28
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 401 588 4.0E-28
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 418 591 4.0E-28
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 418 593 4.0E-28
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 418 593 4.0E-28
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 416 588 4.0E-28
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 418 593 4.0E-28
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 424 593 4.0E-28
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 457 593 5.0E-28
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 457 593 5.0E-28
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 418 593 5.0E-28
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 5.0E-28
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 418 593 5.0E-28
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 418 587 5.0E-28
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 418 588 5.0E-28
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 418 593 5.0E-28
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 418 588 5.0E-28
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 418 588 5.0E-28
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 456 593 5.0E-28
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 396 592 5.0E-28
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 416 594 5.0E-28
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 418 593 5.0E-28
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 418 593 5.0E-28
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 457 593 5.0E-28
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 418 593 5.0E-28
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 416 593 5.0E-28
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 588 5.0E-28
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 401 593 5.0E-28
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 457 593 5.0E-28
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 418 566 5.0E-28
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 457 593 5.0E-28
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 344 593 5.0E-28
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 418 593 5.0E-28
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 457 598 5.0E-28
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 418 588 5.0E-28
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 456 588 5.0E-28
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 401 593 6.0E-28
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 418 593 6.0E-28
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 418 593 6.0E-28
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 457 593 6.0E-28
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 457 593 6.0E-28
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 416 593 6.0E-28
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 418 592 6.0E-28
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 6.0E-28
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 423 593 6.0E-28
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 418 593 6.0E-28
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 391 593 6.0E-28
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 418 593 6.0E-28
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 416 593 6.0E-28
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 418 593 6.0E-28
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 397 593 6.0E-28
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 397 593 6.0E-28
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 401 593 6.0E-28
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 416 593 6.0E-28
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 401 593 6.0E-28
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 457 593 6.0E-28
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 401 588 6.0E-28
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 456 593 6.0E-28
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 457 593 6.0E-28
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 418 593 6.0E-28
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 416 588 6.0E-28
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 457 598 6.0E-28
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 416 588 6.0E-28
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 457 588 6.0E-28
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 457 593 6.0E-28
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 457 584 6.0E-28
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 457 593 7.0E-28
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 418 593 7.0E-28
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 390 593 7.0E-28
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 457 593 7.0E-28
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 457 593 7.0E-28
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 416 588 7.0E-28
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 401 593 7.0E-28
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 439 593 7.0E-28
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 418 593 7.0E-28
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 406 595 7.0E-28
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 457 593 7.0E-28
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 401 593 7.0E-28
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 457 593 7.0E-28
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 476 598 7.0E-28
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 457 593 7.0E-28
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 416 588 7.0E-28
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 418 593 7.0E-28
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 397 593 7.0E-28
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 457 593 8.0E-28
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 378 588 8.0E-28
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 396 593 8.0E-28
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 416 593 8.0E-28
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 418 593 8.0E-28
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 457 593 8.0E-28
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 437 593 8.0E-28
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 400 593 8.0E-28
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 593 8.0E-28
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 459 593 8.0E-28
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 418 593 8.0E-28
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 588 8.0E-28
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 396 588 8.0E-28
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 418 593 8.0E-28
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 399 593 8.0E-28
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 401 593 8.0E-28
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 396 593 8.0E-28
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 457 593 8.0E-28
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 423 593 8.0E-28
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 457 593 8.0E-28
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 396 593 8.0E-28
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 396 593 8.0E-28
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 437 588 8.0E-28
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 457 588 8.0E-28
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 418 593 9.0E-28
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 451 595 9.0E-28
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 418 588 9.0E-28
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 418 588 9.0E-28
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 394 592 9.0E-28
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 400 593 9.0E-28
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 457 593 9.0E-28
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 593 9.0E-28
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 401 593 9.0E-28
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 401 593 9.0E-28
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 418 593 9.0E-28
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 401 576 9.0E-28
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 396 593 9.0E-28
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 418 588 9.0E-28
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 9.0E-28
sp|A8MUV8|ZN727_HUMAN Putative zinc finger protein 727 OS=Homo sapiens GN=ZNF727 PE=5 SV=3 437 593 9.0E-28
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 457 593 1.0E-27
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 456 593 1.0E-27
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 396 588 1.0E-27
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 336 593 1.0E-27
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 391 593 1.0E-27
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 418 593 1.0E-27
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 418 593 1.0E-27
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 401 593 1.0E-27
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 418 592 1.0E-27
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 418 588 1.0E-27
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 439 593 1.0E-27
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 400 593 1.0E-27
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 400 593 1.0E-27
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 400 593 1.0E-27
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 418 588 1.0E-27
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 418 588 1.0E-27
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 400 593 1.0E-27
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 396 593 1.0E-27
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 418 593 1.0E-27
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 472 593 1.0E-27
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 437 593 1.0E-27
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 401 593 1.0E-27
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 394 593 1.0E-27
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 418 595 1.0E-27
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 457 593 1.0E-27
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 418 593 1.0E-27
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 404 593 1.0E-27
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 418 593 1.0E-27
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 469 593 1.0E-27
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 593 1.0E-27
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 397 588 1.0E-27
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 418 598 1.0E-27
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 418 588 1.0E-27
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 418 595 1.0E-27
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 402 588 1.0E-27
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 378 593 1.0E-27
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 401 588 1.0E-27
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 356 593 1.0E-27
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 418 588 1.0E-27
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 418 593 1.0E-27
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 595 1.0E-27
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 418 593 1.0E-27
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 416 593 1.0E-27
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 416 593 1.0E-27
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 403 593 1.0E-27
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 418 593 1.0E-27
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 418 593 1.0E-27
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 416 588 1.0E-27
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 432 593 1.0E-27
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 418 593 1.0E-27
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 418 588 1.0E-27
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 400 598 1.0E-27
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 406 593 1.0E-27
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 418 588 1.0E-27
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 418 593 1.0E-27
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 418 593 1.0E-27
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 401 593 1.0E-27
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 401 593 1.0E-27
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 420 593 1.0E-27
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 416 593 1.0E-27
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 401 593 1.0E-27
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 457 593 1.0E-27
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 418 593 1.0E-27
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 456 593 1.0E-27
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 418 593 1.0E-27
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 418 588 1.0E-27
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 457 593 1.0E-27
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 476 598 1.0E-27
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 1.0E-27
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 418 593 1.0E-27
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 457 588 1.0E-27
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 457 588 1.0E-27
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 439 593 2.0E-27
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 418 593 2.0E-27
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 416 593 2.0E-27
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 418 593 2.0E-27
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 414 595 2.0E-27
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 418 593 2.0E-27
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 418 593 2.0E-27
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 414 595 2.0E-27
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 418 593 2.0E-27
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 401 592 2.0E-27
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 413 595 2.0E-27
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 403 588 2.0E-27
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 418 593 2.0E-27
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 401 593 2.0E-27
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 416 588 2.0E-27
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 457 593 2.0E-27
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 378 592 2.0E-27
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 467 593 2.0E-27
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 414 588 2.0E-27
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 418 593 2.0E-27
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 416 593 2.0E-27
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 593 2.0E-27
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 418 588 2.0E-27
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 418 593 2.0E-27
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 416 593 2.0E-27
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 457 593 2.0E-27
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 457 593 2.0E-27
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 467 595 2.0E-27
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 418 595 2.0E-27
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 467 595 2.0E-27
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 418 595 2.0E-27
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 418 593 2.0E-27
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 456 593 2.0E-27
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 415 593 2.0E-27
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 457 593 2.0E-27
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 401 595 2.0E-27
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 401 588 2.0E-27
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 418 593 2.0E-27
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 418 593 2.0E-27
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 418 588 2.0E-27
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 415 593 2.0E-27
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 451 593 2.0E-27
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 401 593 2.0E-27
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 416 593 2.0E-27
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 459 593 2.0E-27
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 396 593 2.0E-27
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 418 595 2.0E-27
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 399 593 2.0E-27
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 401 593 2.0E-27
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 416 593 2.0E-27
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 397 593 2.0E-27
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 407 588 2.0E-27
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 418 593 2.0E-27
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 379 588 2.0E-27
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 406 593 2.0E-27
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 406 595 2.0E-27
sp|A8MUV8|ZN727_HUMAN Putative zinc finger protein 727 OS=Homo sapiens GN=ZNF727 PE=5 SV=3 401 593 2.0E-27
sp|E7ETH6|Z587B_HUMAN Zinc finger protein 587B OS=Homo sapiens GN=ZNF587B PE=1 SV=1 426 589 2.0E-27
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 457 588 2.0E-27
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 400 588 2.0E-27
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 418 588 2.0E-27
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 416 593 2.0E-27
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 456 593 2.0E-27
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 457 598 2.0E-27
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 588 2.0E-27
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 396 593 2.0E-27
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 416 593 2.0E-27
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 418 593 2.0E-27
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 401 593 2.0E-27
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 418 593 2.0E-27
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 588 2.0E-27
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 401 588 2.0E-27
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 426 588 2.0E-27
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 397 593 2.0E-27
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 456 593 2.0E-27
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 393 593 3.0E-27
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 418 593 3.0E-27
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 416 593 3.0E-27
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 401 593 3.0E-27
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 476 593 3.0E-27
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 401 593 3.0E-27
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 396 593 3.0E-27
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 457 593 3.0E-27
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 418 593 3.0E-27
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 418 593 3.0E-27
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 394 588 3.0E-27
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 418 593 3.0E-27
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 457 593 3.0E-27
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 418 587 3.0E-27
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 456 590 3.0E-27
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 472 593 3.0E-27
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 401 596 3.0E-27
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 404 593 3.0E-27
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 457 593 3.0E-27
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 394 593 3.0E-27
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 459 593 3.0E-27
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 391 593 3.0E-27
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 457 593 3.0E-27
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 418 595 3.0E-27
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 418 593 3.0E-27
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 411 588 3.0E-27
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 418 588 3.0E-27
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 401 588 3.0E-27
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 456 588 3.0E-27
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 457 595 3.0E-27
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 456 593 3.0E-27
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 439 595 3.0E-27
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 378 588 3.0E-27
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 418 593 3.0E-27
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 457 588 3.0E-27
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 418 592 3.0E-27
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 418 593 4.0E-27
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 418 593 4.0E-27
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 418 593 4.0E-27
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 429 593 4.0E-27
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 418 593 4.0E-27
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 588 4.0E-27
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 378 588 4.0E-27
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 418 593 4.0E-27
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 416 593 4.0E-27
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 418 593 4.0E-27
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 396 588 4.0E-27
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 394 593 4.0E-27
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 397 593 4.0E-27
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 416 593 4.0E-27
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 457 593 4.0E-27
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 403 593 4.0E-27
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 416 592 4.0E-27
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 418 593 4.0E-27
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 418 593 4.0E-27
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 418 597 4.0E-27
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 439 593 4.0E-27
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 418 595 4.0E-27
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 397 593 4.0E-27
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 418 593 4.0E-27
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 457 588 4.0E-27
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 410 596 4.0E-27
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 593 4.0E-27
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 431 593 4.0E-27
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 457 595 4.0E-27
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 457 592 4.0E-27
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 401 596 4.0E-27
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 457 593 4.0E-27
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 416 593 4.0E-27
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 395 590 4.0E-27
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 394 593 5.0E-27
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 418 593 5.0E-27
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 457 588 5.0E-27
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 437 588 5.0E-27
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 459 593 5.0E-27
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 406 593 5.0E-27
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 406 593 5.0E-27
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 418 593 5.0E-27
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 5.0E-27
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 408 593 5.0E-27
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 396 593 5.0E-27
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 457 595 5.0E-27
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 379 593 5.0E-27
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 430 595 5.0E-27
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 430 595 5.0E-27
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 396 588 5.0E-27
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 401 588 5.0E-27
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 416 593 5.0E-27
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 401 595 5.0E-27
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 476 598 5.0E-27
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 410 593 5.0E-27
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 418 596 5.0E-27
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 400 588 5.0E-27
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 416 593 6.0E-27
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 379 591 6.0E-27
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 454 593 6.0E-27
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 459 593 6.0E-27
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 418 593 6.0E-27
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 588 6.0E-27
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 401 592 6.0E-27
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 418 593 6.0E-27
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 457 593 6.0E-27
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 457 593 6.0E-27
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 457 593 6.0E-27
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 396 593 6.0E-27
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 588 6.0E-27
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 418 590 6.0E-27
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 439 593 6.0E-27
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 396 593 6.0E-27
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 457 595 6.0E-27
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 418 588 6.0E-27
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 396 588 6.0E-27
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 418 595 6.0E-27
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 464 593 6.0E-27
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 457 593 6.0E-27
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 418 593 6.0E-27
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 432 588 6.0E-27
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 418 585 6.0E-27
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 418 593 6.0E-27
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 401 593 7.0E-27
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 396 588 7.0E-27
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 418 595 7.0E-27
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 444 595 7.0E-27
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 437 593 7.0E-27
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 457 588 7.0E-27
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 401 593 7.0E-27
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 401 593 7.0E-27
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 414 595 7.0E-27
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 401 588 7.0E-27
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 391 593 7.0E-27
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 400 588 7.0E-27
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 411 593 7.0E-27
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 401 595 7.0E-27
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 439 595 7.0E-27
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 457 591 7.0E-27
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 418 584 7.0E-27
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 418 584 7.0E-27
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 450 593 8.0E-27
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 418 595 8.0E-27
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 418 593 8.0E-27
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 467 593 8.0E-27
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 396 588 8.0E-27
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 457 593 8.0E-27
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 457 588 8.0E-27
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 432 593 8.0E-27
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 418 588 8.0E-27
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 396 588 8.0E-27
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 467 593 8.0E-27
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 401 593 8.0E-27
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 457 593 8.0E-27
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 401 593 8.0E-27
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 418 593 8.0E-27
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 418 593 8.0E-27
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 414 595 8.0E-27
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 418 593 9.0E-27
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 391 593 9.0E-27
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 418 593 9.0E-27
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 418 593 9.0E-27
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 396 588 9.0E-27
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 401 593 9.0E-27
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 418 595 9.0E-27
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 416 593 9.0E-27
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 416 588 9.0E-27
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 418 588 9.0E-27
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 396 593 9.0E-27
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 418 597 9.0E-27
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 396 593 1.0E-26
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 401 593 1.0E-26
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 457 593 1.0E-26
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 401 593 1.0E-26
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 397 593 1.0E-26
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 418 593 1.0E-26
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 416 593 1.0E-26
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 401 588 1.0E-26
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 418 593 1.0E-26
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 416 593 1.0E-26
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 416 593 1.0E-26
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 418 593 1.0E-26
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 343 593 1.0E-26
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 406 593 1.0E-26
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 406 593 1.0E-26
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 406 593 1.0E-26
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 401 588 1.0E-26
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 406 588 1.0E-26
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 396 588 1.0E-26
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 418 593 1.0E-26
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 401 593 1.0E-26
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 467 593 1.0E-26
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 392 593 1.0E-26
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 418 588 1.0E-26
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 418 595 1.0E-26
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 407 593 1.0E-26
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 396 588 1.0E-26
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 437 593 1.0E-26
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 418 593 1.0E-26
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 418 592 1.0E-26
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 418 590 1.0E-26
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 437 593 1.0E-26
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 391 588 1.0E-26
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 403 593 1.0E-26
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 429 593 1.0E-26
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 400 593 1.0E-26
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 401 588 1.0E-26
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 418 593 1.0E-26
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 418 593 1.0E-26
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 418 593 1.0E-26
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 404 595 1.0E-26
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 404 593 1.0E-26
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 418 593 1.0E-26
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 397 593 1.0E-26
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 1.0E-26
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 423 593 1.0E-26
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 401 593 1.0E-26
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 403 588 1.0E-26
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 457 593 1.0E-26
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 391 588 2.0E-26
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 418 588 2.0E-26
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 401 593 2.0E-26
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 378 593 2.0E-26
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 397 593 2.0E-26
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 457 593 2.0E-26
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 418 595 2.0E-26
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 456 593 2.0E-26
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 397 568 2.0E-26
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 418 593 2.0E-26
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 457 593 2.0E-26
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 457 593 2.0E-26
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 401 588 2.0E-26
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 457 595 2.0E-26
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 456 595 2.0E-26
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 418 595 2.0E-26
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 418 593 2.0E-26
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 457 593 2.0E-26
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 396 593 2.0E-26
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 416 593 2.0E-26
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 467 593 2.0E-26
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 457 595 2.0E-26
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 467 593 2.0E-26
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 362 593 2.0E-26
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 416 593 2.0E-26
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 588 2.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 457 593 2.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 2.0E-26
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 396 593 2.0E-26
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 416 593 2.0E-26
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 396 593 2.0E-26
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 406 591 2.0E-26
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 418 588 2.0E-26
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 418 582 2.0E-26
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 418 593 2.0E-26
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 411 588 2.0E-26
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 418 593 2.0E-26
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 398 595 2.0E-26
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 401 582 2.0E-26
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 416 593 2.0E-26
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 400 593 2.0E-26
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 418 593 2.0E-26
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 398 595 2.0E-26
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 457 595 2.0E-26
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 465 593 2.0E-26
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 396 595 2.0E-26
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 457 593 2.0E-26
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 457 593 2.0E-26
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 457 593 2.0E-26
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 406 593 2.0E-26
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 416 598 2.0E-26
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 2.0E-26
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 457 593 2.0E-26
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 418 593 2.0E-26
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 418 593 2.0E-26
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 416 588 2.0E-26
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 403 593 2.0E-26
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 457 595 2.0E-26
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 397 595 2.0E-26
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 391 593 2.0E-26
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 400 588 2.0E-26
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 418 593 2.0E-26
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 418 593 3.0E-26
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 418 595 3.0E-26
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 416 588 3.0E-26
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 457 593 3.0E-26
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 416 593 3.0E-26
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 418 593 3.0E-26
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 3.0E-26
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 418 593 3.0E-26
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 457 593 3.0E-26
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 416 593 3.0E-26
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 459 593 3.0E-26
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 418 593 3.0E-26
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 418 584 3.0E-26
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 400 593 3.0E-26
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 418 593 3.0E-26
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 388 593 3.0E-26
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 416 593 3.0E-26
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 396 593 3.0E-26
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 418 584 3.0E-26
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 457 593 3.0E-26
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 401 593 3.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 3.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 3.0E-26
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 457 593 3.0E-26
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 401 593 3.0E-26
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 418 588 3.0E-26
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 406 588 3.0E-26
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 418 588 3.0E-26
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 418 588 3.0E-26
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 420 593 3.0E-26
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 418 593 3.0E-26
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 457 588 3.0E-26
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 418 593 3.0E-26
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 414 591 3.0E-26
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 418 593 3.0E-26
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 418 588 3.0E-26
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 400 588 3.0E-26
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 418 593 3.0E-26
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 399 588 3.0E-26
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 429 593 3.0E-26
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 429 593 3.0E-26
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 457 593 3.0E-26
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 418 588 3.0E-26
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 418 595 3.0E-26
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 397 593 3.0E-26
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 418 588 3.0E-26
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 401 593 3.0E-26
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 457 588 3.0E-26
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 418 593 4.0E-26
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 457 593 4.0E-26
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 444 594 4.0E-26
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 418 595 4.0E-26
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 401 593 4.0E-26
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 415 592 4.0E-26
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 401 593 4.0E-26
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 393 593 4.0E-26
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 457 593 4.0E-26
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 401 593 4.0E-26
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 396 593 4.0E-26
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 418 593 4.0E-26
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 416 593 4.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 401 588 4.0E-26
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 458 592 4.0E-26
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 418 593 4.0E-26
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 418 593 4.0E-26
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 418 593 4.0E-26
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 418 593 4.0E-26
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 457 593 4.0E-26
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 418 588 4.0E-26
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 396 593 4.0E-26
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 398 595 4.0E-26
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 457 593 4.0E-26
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 400 588 4.0E-26
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 418 593 4.0E-26
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 416 568 4.0E-26
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 4.0E-26
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 457 593 4.0E-26
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 467 593 5.0E-26
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 457 593 5.0E-26
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 437 588 5.0E-26
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 401 593 5.0E-26
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 593 5.0E-26
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 457 593 5.0E-26
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 457 593 5.0E-26
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 397 593 5.0E-26
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 418 593 5.0E-26
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 456 595 5.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 415 593 5.0E-26
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 401 593 5.0E-26
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 457 595 5.0E-26
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 350 595 5.0E-26
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 457 593 5.0E-26
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 457 588 5.0E-26
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 444 593 5.0E-26
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 418 593 6.0E-26
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 401 588 6.0E-26
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 418 593 6.0E-26
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 457 593 6.0E-26
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 457 593 6.0E-26
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 401 593 6.0E-26
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 593 6.0E-26
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 429 593 6.0E-26
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 416 588 6.0E-26
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 418 593 6.0E-26
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 457 593 6.0E-26
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 388 588 6.0E-26
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 418 593 6.0E-26
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 418 588 6.0E-26
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 418 593 6.0E-26
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 394 593 6.0E-26
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 416 593 6.0E-26
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 418 588 6.0E-26
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 456 593 7.0E-26
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 418 593 7.0E-26
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 418 593 7.0E-26
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 448 593 7.0E-26
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 457 593 7.0E-26
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 457 593 7.0E-26
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 418 593 7.0E-26
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 457 588 7.0E-26
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 418 588 7.0E-26
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 403 593 7.0E-26
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 456 595 7.0E-26
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 418 593 7.0E-26
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 401 593 8.0E-26
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 415 593 8.0E-26
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 416 593 8.0E-26
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 361 575 8.0E-26
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 457 593 8.0E-26
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 418 588 8.0E-26
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 363 593 8.0E-26
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 401 593 8.0E-26
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 456 593 8.0E-26
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 418 588 8.0E-26
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 457 588 8.0E-26
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 8.0E-26
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 418 593 8.0E-26
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 406 588 9.0E-26
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 453 593 9.0E-26
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 457 593 9.0E-26
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 418 588 9.0E-26
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 401 593 9.0E-26
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 418 593 9.0E-26
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 398 595 9.0E-26
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 416 595 9.0E-26
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 416 588 9.0E-26
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 418 589 9.0E-26
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 418 595 9.0E-26
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 457 593 9.0E-26
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 459 595 9.0E-26
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 381 588 9.0E-26
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 366 588 9.0E-26
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 388 593 1.0E-25
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 394 588 1.0E-25
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 401 592 1.0E-25
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 459 593 1.0E-25
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 401 588 1.0E-25
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 418 588 1.0E-25
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 470 593 1.0E-25
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 418 593 1.0E-25
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 459 593 1.0E-25
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 396 586 1.0E-25
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 418 593 1.0E-25
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 401 593 1.0E-25
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 406 588 1.0E-25
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 406 588 1.0E-25
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 418 593 1.0E-25
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 401 593 1.0E-25
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 416 593 1.0E-25
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 401 593 1.0E-25
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 401 593 1.0E-25
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 401 593 1.0E-25
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 457 593 1.0E-25
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 406 593 1.0E-25
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 418 593 1.0E-25
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 378 593 1.0E-25
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 418 588 1.0E-25
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 457 593 1.0E-25
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 465 595 1.0E-25
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 459 593 1.0E-25
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 418 588 1.0E-25
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 418 588 1.0E-25
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 354 593 1.0E-25
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 418 589 1.0E-25
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 401 595 1.0E-25
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 418 588 1.0E-25
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 416 593 1.0E-25
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 398 595 1.0E-25
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 588 1.0E-25
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 467 593 1.0E-25
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 457 593 1.0E-25
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 397 593 1.0E-25
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 396 593 1.0E-25
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 403 593 1.0E-25
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 418 588 1.0E-25
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 457 593 1.0E-25
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 405 593 1.0E-25
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 457 593 1.0E-25
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 401 593 1.0E-25
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 414 593 1.0E-25
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 459 595 1.0E-25
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 418 595 1.0E-25
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 418 595 1.0E-25
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 440 593 1.0E-25
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 418 593 1.0E-25
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 411 588 1.0E-25
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 457 595 1.0E-25
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 388 593 2.0E-25
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 418 595 2.0E-25
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 401 593 2.0E-25
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 378 592 2.0E-25
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 418 593 2.0E-25
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 418 593 2.0E-25
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 451 593 2.0E-25
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 416 593 2.0E-25
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 418 597 2.0E-25
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 418 588 2.0E-25
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 401 593 2.0E-25
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 457 593 2.0E-25
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 416 593 2.0E-25
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 450 586 2.0E-25
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 401 588 2.0E-25
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 467 593 2.0E-25
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 418 593 2.0E-25
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 393 593 2.0E-25
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 457 593 2.0E-25
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 416 593 2.0E-25
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 401 588 2.0E-25
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 401 588 2.0E-25
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 470 593 2.0E-25
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 401 593 2.0E-25
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 401 593 2.0E-25
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 457 593 2.0E-25
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 418 593 2.0E-25
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 418 593 2.0E-25
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 416 588 2.0E-25
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 391 588 2.0E-25
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 418 593 2.0E-25
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 401 592 2.0E-25
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 401 593 2.0E-25
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 418 561 2.0E-25
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 418 593 2.0E-25
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 418 595 2.0E-25
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 401 593 2.0E-25
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 416 593 2.0E-25
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 418 588 2.0E-25
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 593 2.0E-25
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 416 593 2.0E-25
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 418 593 2.0E-25
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 418 593 2.0E-25
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 418 593 2.0E-25
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 440 588 2.0E-25
sp|A8MUV8|ZN727_HUMAN Putative zinc finger protein 727 OS=Homo sapiens GN=ZNF727 PE=5 SV=3 412 595 2.0E-25
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 416 593 2.0E-25
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 418 593 2.0E-25
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 348 593 2.0E-25
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 418 593 2.0E-25
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 443 595 2.0E-25
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 418 588 3.0E-25
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 396 593 3.0E-25
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 467 593 3.0E-25
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 418 597 3.0E-25
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 418 597 3.0E-25
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 418 593 3.0E-25
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 403 593 3.0E-25
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 467 593 3.0E-25
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 418 593 3.0E-25
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 457 593 3.0E-25
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 401 586 3.0E-25
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 418 593 3.0E-25
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 396 593 3.0E-25
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 418 593 3.0E-25
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 418 593 3.0E-25
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 416 593 3.0E-25
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 457 588 3.0E-25
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 396 593 3.0E-25
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 418 593 3.0E-25
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 398 593 3.0E-25
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 418 561 3.0E-25
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 425 588 3.0E-25
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 457 584 3.0E-25
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 450 593 3.0E-25
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 457 588 3.0E-25
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 457 588 3.0E-25
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 418 593 3.0E-25
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 311 593 3.0E-25
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 396 588 3.0E-25
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 418 588 3.0E-25
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 593 3.0E-25
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 450 590 3.0E-25
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 465 588 3.0E-25
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 418 588 4.0E-25
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 400 593 4.0E-25
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 416 593 4.0E-25
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 397 595 4.0E-25
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 397 595 4.0E-25
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 403 588 4.0E-25
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 592 4.0E-25
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 418 575 4.0E-25
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 361 568 4.0E-25
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 401 593 4.0E-25
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 418 561 4.0E-25
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 418 561 4.0E-25
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 418 561 4.0E-25
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 418 561 4.0E-25
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 418 593 4.0E-25
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 379 593 4.0E-25
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 397 593 4.0E-25
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 393 593 4.0E-25
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 588 4.0E-25
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 418 593 4.0E-25
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 418 597 4.0E-25
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 400 593 4.0E-25
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 413 593 5.0E-25
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 467 593 5.0E-25
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 476 593 5.0E-25
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 476 593 5.0E-25
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 418 597 5.0E-25
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 457 595 5.0E-25
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 401 595 5.0E-25
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 401 593 5.0E-25
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 457 595 5.0E-25
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 367 593 5.0E-25
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 457 593 5.0E-25
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 457 588 5.0E-25
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 467 593 5.0E-25
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 418 588 5.0E-25
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 439 593 5.0E-25
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 457 588 5.0E-25
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 588 5.0E-25
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 457 593 5.0E-25
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 457 596 5.0E-25
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 595 5.0E-25
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 406 593 5.0E-25
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 418 593 5.0E-25
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 406 595 5.0E-25
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 459 593 6.0E-25
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 391 588 6.0E-25
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 457 592 6.0E-25
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 403 570 6.0E-25
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 467 593 6.0E-25
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 455 593 6.0E-25
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 416 593 6.0E-25
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 401 593 6.0E-25
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 473 593 6.0E-25
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 400 593 6.0E-25
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 457 589 6.0E-25
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 428 593 7.0E-25
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 396 593 7.0E-25
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 476 593 7.0E-25
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 467 593 7.0E-25
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 418 593 7.0E-25
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 416 593 7.0E-25
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 393 593 7.0E-25
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 418 593 7.0E-25
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 401 588 7.0E-25
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 401 593 7.0E-25
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 457 593 7.0E-25
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 457 593 8.0E-25
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 423 593 8.0E-25
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 397 595 8.0E-25
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 390 593 8.0E-25
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 401 588 8.0E-25
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 401 593 8.0E-25
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 423 593 8.0E-25
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 378 593 8.0E-25
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 588 8.0E-25
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 457 593 8.0E-25
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 594 9.0E-25
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 418 588 9.0E-25
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 455 593 9.0E-25
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 400 593 9.0E-25
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 472 593 9.0E-25
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 393 593 9.0E-25
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 392 593 9.0E-25
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 416 593 9.0E-25
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 457 596 9.0E-25
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 418 590 9.0E-25
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 476 593 1.0E-24
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 416 593 1.0E-24
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 459 593 1.0E-24
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 418 593 1.0E-24
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 393 593 1.0E-24
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 456 593 1.0E-24
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 476 593 1.0E-24
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 467 593 1.0E-24
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 593 1.0E-24
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 418 593 1.0E-24
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 416 559 1.0E-24
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 476 593 1.0E-24
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 416 559 1.0E-24
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 593 1.0E-24
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 416 588 1.0E-24
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 418 595 1.0E-24
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 418 593 1.0E-24
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 473 593 1.0E-24
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 476 593 1.0E-24
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 476 593 1.0E-24
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 418 590 1.0E-24
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 396 584 1.0E-24
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 457 588 1.0E-24
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 397 595 1.0E-24
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 418 593 1.0E-24
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 418 593 1.0E-24
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 463 594 1.0E-24
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 440 593 1.0E-24
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 418 595 1.0E-24
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 418 588 1.0E-24
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 396 593 1.0E-24
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 379 595 1.0E-24
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 418 593 1.0E-24
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 451 593 1.0E-24
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 418 593 1.0E-24
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 468 588 1.0E-24
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 418 593 1.0E-24
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 416 588 1.0E-24
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 468 593 1.0E-24
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 401 593 1.0E-24
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 468 588 1.0E-24
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 416 563 1.0E-24
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 1.0E-24
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 380 593 1.0E-24
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 416 593 1.0E-24
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 462 595 1.0E-24
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 468 593 2.0E-24
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 416 588 2.0E-24
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 593 2.0E-24
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 401 564 2.0E-24
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 456 593 2.0E-24
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 396 593 2.0E-24
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 396 593 2.0E-24
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 476 593 2.0E-24
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 403 595 2.0E-24
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 457 593 2.0E-24
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 457 593 2.0E-24
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 416 593 2.0E-24
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 410 587 2.0E-24
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 409 593 2.0E-24
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 457 588 2.0E-24
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 418 588 2.0E-24
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 416 593 2.0E-24
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 428 593 2.0E-24
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 440 593 2.0E-24
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 460 588 2.0E-24
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 473 595 2.0E-24
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 401 588 2.0E-24
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 439 588 2.0E-24
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 401 593 2.0E-24
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 418 593 2.0E-24
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 418 593 2.0E-24
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 418 593 2.0E-24
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 440 588 2.0E-24
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 361 588 2.0E-24
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 371 593 2.0E-24
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 468 593 2.0E-24
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 401 593 2.0E-24
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 418 593 2.0E-24
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 406 593 2.0E-24
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 418 597 2.0E-24
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 340 593 2.0E-24
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 451 588 2.0E-24
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 470 593 3.0E-24
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 465 593 3.0E-24
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 476 593 3.0E-24
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 423 593 3.0E-24
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 418 593 3.0E-24
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 471 593 3.0E-24
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 418 588 3.0E-24
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 437 593 3.0E-24
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 396 593 3.0E-24
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 3.0E-24
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 418 588 3.0E-24
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 457 593 3.0E-24
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 418 588 3.0E-24
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 456 593 3.0E-24
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 401 593 3.0E-24
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 418 595 3.0E-24
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 473 593 3.0E-24
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 473 593 3.0E-24
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 418 562 3.0E-24
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 457 589 3.0E-24
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 467 593 3.0E-24
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 457 595 3.0E-24
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 418 588 3.0E-24
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 449 595 3.0E-24
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 418 588 3.0E-24
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 416 563 3.0E-24
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 416 563 3.0E-24
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 396 593 3.0E-24
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 456 588 3.0E-24
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 588 3.0E-24
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 418 588 3.0E-24
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 457 593 3.0E-24
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 418 593 3.0E-24
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 416 595 3.0E-24
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 456 593 3.0E-24
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 418 582 4.0E-24
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 418 593 4.0E-24
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 396 593 4.0E-24
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 416 593 4.0E-24
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 457 595 4.0E-24
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 418 593 4.0E-24
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 418 593 4.0E-24
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 457 588 4.0E-24
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 401 595 4.0E-24
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 457 593 4.0E-24
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 392 593 4.0E-24
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 457 588 4.0E-24
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 401 590 4.0E-24
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 457 589 4.0E-24
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 396 595 4.0E-24
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 418 593 4.0E-24
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 457 593 4.0E-24
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 457 593 4.0E-24
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 361 595 4.0E-24
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 413 593 4.0E-24
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 418 593 4.0E-24
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 366 593 4.0E-24
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 439 584 5.0E-24
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 476 593 5.0E-24
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 456 593 5.0E-24
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 401 564 5.0E-24
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 416 592 5.0E-24
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 457 589 5.0E-24
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 401 593 5.0E-24
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 383 593 5.0E-24
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 437 593 5.0E-24
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 394 595 5.0E-24
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 418 588 5.0E-24
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 416 595 6.0E-24
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 416 593 6.0E-24
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 401 561 6.0E-24
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 440 593 6.0E-24
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 457 593 6.0E-24
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 418 593 6.0E-24
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 416 593 6.0E-24
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 473 593 6.0E-24
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 418 588 6.0E-24
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 416 574 6.0E-24
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 457 595 6.0E-24
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 457 591 6.0E-24
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 399 588 7.0E-24
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 418 593 7.0E-24
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 456 588 7.0E-24
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 457 588 7.0E-24
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 416 593 7.0E-24
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 389 593 7.0E-24
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 476 593 7.0E-24
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 416 595 7.0E-24
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 473 593 7.0E-24
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 420 593 7.0E-24
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 457 593 7.0E-24
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 418 593 7.0E-24
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 418 593 7.0E-24
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 477 593 8.0E-24
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 391 595 8.0E-24
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 396 564 8.0E-24
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 395 593 8.0E-24
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 418 568 9.0E-24
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 418 588 9.0E-24
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 401 588 9.0E-24
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 457 593 9.0E-24
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 471 593 9.0E-24
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 418 588 9.0E-24
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 396 593 9.0E-24
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 420 593 9.0E-24
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 467 593 1.0E-23
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 418 588 1.0E-23
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 418 588 1.0E-23
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 418 588 1.0E-23
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 454 593 1.0E-23
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 418 593 1.0E-23
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 457 593 1.0E-23
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 418 566 1.0E-23
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 476 593 1.0E-23
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 457 593 1.0E-23
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 454 593 1.0E-23
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 443 593 1.0E-23
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 406 593 1.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 418 593 1.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 411 593 1.0E-23
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 443 593 1.0E-23
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 457 593 1.0E-23
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 455 593 1.0E-23
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 418 593 1.0E-23
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 456 593 1.0E-23
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 457 593 1.0E-23
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 457 593 1.0E-23
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 418 588 1.0E-23
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 457 593 1.0E-23
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 418 561 1.0E-23
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 396 593 1.0E-23
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 423 593 1.0E-23
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 418 593 1.0E-23
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 420 593 1.0E-23
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 472 593 1.0E-23
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 457 590 1.0E-23
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 418 592 1.0E-23
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 416 588 1.0E-23
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 418 588 1.0E-23
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 413 584 2.0E-23
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 447 595 2.0E-23
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 418 567 2.0E-23
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 401 593 2.0E-23
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 416 588 2.0E-23
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 401 593 2.0E-23
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 418 592 2.0E-23
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 418 588 2.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 391 593 2.0E-23
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 418 593 2.0E-23
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 418 595 2.0E-23
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 456 593 2.0E-23
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 418 588 2.0E-23
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 480 593 2.0E-23
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 467 593 2.0E-23
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 420 593 2.0E-23
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 405 593 2.0E-23
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 476 595 2.0E-23
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 457 588 2.0E-23
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 457 593 2.0E-23
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 418 593 2.0E-23
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 446 593 2.0E-23
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 411 593 2.0E-23
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 480 593 2.0E-23
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 457 593 2.0E-23
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 413 593 2.0E-23
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 416 561 2.0E-23
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 416 593 2.0E-23
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 394 595 2.0E-23
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 460 593 3.0E-23
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 473 593 3.0E-23
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 392 566 3.0E-23
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 474 594 3.0E-23
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 474 591 3.0E-23
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 460 595 3.0E-23
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 401 593 3.0E-23
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 457 593 3.0E-23
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 476 593 3.0E-23
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 416 588 3.0E-23
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 416 593 3.0E-23
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 452 593 3.0E-23
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 418 593 3.0E-23
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 396 593 3.0E-23
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 418 593 3.0E-23
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 408 595 3.0E-23
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 401 593 3.0E-23
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 406 593 3.0E-23
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 401 593 3.0E-23
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 593 3.0E-23
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 418 595 3.0E-23
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 398 588 3.0E-23
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 401 593 3.0E-23
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 396 584 3.0E-23
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 418 588 3.0E-23
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 593 3.0E-23
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 418 591 3.0E-23
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 457 593 3.0E-23
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 418 591 3.0E-23
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 404 578 4.0E-23
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 406 584 4.0E-23
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 413 584 4.0E-23
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 457 593 4.0E-23
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 418 593 4.0E-23
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 418 588 4.0E-23
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 456 597 4.0E-23
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 470 588 4.0E-23
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 470 588 4.0E-23
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 474 593 4.0E-23
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 564 4.0E-23
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 396 566 4.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 416 593 4.0E-23
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 418 560 4.0E-23
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 420 593 4.0E-23
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 400 593 4.0E-23
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 390 593 4.0E-23
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 439 593 4.0E-23
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 418 593 4.0E-23
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 588 4.0E-23
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 416 593 4.0E-23
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 418 560 5.0E-23
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 477 593 5.0E-23
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 418 588 5.0E-23
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 457 593 5.0E-23
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 457 564 5.0E-23
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 397 593 5.0E-23
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 408 595 5.0E-23
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 457 595 5.0E-23
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 457 593 5.0E-23
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 467 593 5.0E-23
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 5.0E-23
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 403 593 5.0E-23
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 418 593 5.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 476 593 6.0E-23
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 418 595 6.0E-23
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 457 593 6.0E-23
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 457 587 6.0E-23
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 416 593 6.0E-23
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 418 588 6.0E-23
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 400 593 6.0E-23
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 396 584 6.0E-23
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 306 593 6.0E-23
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 465 593 6.0E-23
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 393 593 6.0E-23
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 411 593 7.0E-23
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 457 593 7.0E-23
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 418 559 7.0E-23
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 416 593 7.0E-23
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 456 593 7.0E-23
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 457 588 7.0E-23
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 459 593 7.0E-23
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 451 591 7.0E-23
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 418 588 7.0E-23
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 456 593 7.0E-23
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 404 578 8.0E-23
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 465 593 8.0E-23
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 401 597 8.0E-23
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 476 593 8.0E-23
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 457 593 8.0E-23
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 401 588 8.0E-23
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 467 593 8.0E-23
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 418 593 8.0E-23
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 418 593 8.0E-23
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 457 569 8.0E-23
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 419 593 8.0E-23
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 459 593 8.0E-23
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 418 593 8.0E-23
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 396 586 8.0E-23
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 411 588 8.0E-23
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 397 593 8.0E-23
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 418 593 8.0E-23
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 404 561 9.0E-23
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 418 594 9.0E-23
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 416 593 9.0E-23
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 414 593 9.0E-23
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 418 598 9.0E-23
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 469 593 9.0E-23
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 419 593 9.0E-23
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 404 561 1.0E-22
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 404 561 1.0E-22
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 457 593 1.0E-22
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 418 564 1.0E-22
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 356 593 1.0E-22
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 469 593 1.0E-22
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 479 593 1.0E-22
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 474 593 1.0E-22
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 476 593 1.0E-22
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 418 588 1.0E-22
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 457 593 1.0E-22
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 391 592 1.0E-22
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 474 593 1.0E-22
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 418 566 1.0E-22
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 418 588 1.0E-22
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 414 593 1.0E-22
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 401 561 1.0E-22
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 416 593 1.0E-22
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 401 588 1.0E-22
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 396 588 1.0E-22
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 418 561 1.0E-22
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 474 593 1.0E-22
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 476 593 1.0E-22
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 472 593 1.0E-22
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 467 593 1.0E-22
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 476 593 1.0E-22
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 418 597 1.0E-22
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 416 593 1.0E-22
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 418 593 1.0E-22
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 416 588 1.0E-22
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 418 588 1.0E-22
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 404 578 2.0E-22
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 404 578 2.0E-22
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 418 582 2.0E-22
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 476 593 2.0E-22
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 459 593 2.0E-22
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 418 593 2.0E-22
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 465 593 2.0E-22
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 396 588 2.0E-22
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 414 593 2.0E-22
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 414 593 2.0E-22
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 416 593 2.0E-22
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 457 588 2.0E-22
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 457 593 2.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 418 598 2.0E-22
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 400 562 2.0E-22
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 457 564 2.0E-22
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 412 588 2.0E-22
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 418 588 2.0E-22
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 358 593 2.0E-22
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 457 593 2.0E-22
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 420 593 2.0E-22
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 457 593 2.0E-22
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 418 593 2.0E-22
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 457 593 2.0E-22
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 396 590 2.0E-22
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 588 2.0E-22
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 439 595 2.0E-22
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 593 2.0E-22
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 378 591 2.0E-22
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 456 588 2.0E-22
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 394 593 2.0E-22
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 456 588 2.0E-22
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 404 557 3.0E-22
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 404 557 3.0E-22
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 401 593 3.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 476 593 3.0E-22
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 396 586 3.0E-22
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 476 593 3.0E-22
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 392 593 3.0E-22
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 418 588 3.0E-22
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 418 588 3.0E-22
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 457 588 3.0E-22
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 403 595 3.0E-22
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 400 562 3.0E-22
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 451 593 3.0E-22
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 416 593 3.0E-22
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 457 593 3.0E-22
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 418 593 3.0E-22
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 416 588 3.0E-22
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 459 593 3.0E-22
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 468 593 3.0E-22
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 415 595 3.0E-22
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 595 3.0E-22
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 476 593 4.0E-22
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 401 561 4.0E-22
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 457 560 4.0E-22
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 457 593 4.0E-22
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 564 4.0E-22
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 418 559 4.0E-22
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 416 597 4.0E-22
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 396 593 4.0E-22
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 477 595 4.0E-22
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 459 593 4.0E-22
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 405 593 4.0E-22
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 459 593 4.0E-22
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 404 557 5.0E-22
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 476 593 5.0E-22
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 401 570 5.0E-22
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 479 593 5.0E-22
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 448 593 5.0E-22
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 411 593 5.0E-22
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 418 593 5.0E-22
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 397 561 5.0E-22
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 418 560 6.0E-22
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 478 595 6.0E-22
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 379 588 6.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 401 562 6.0E-22
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 457 593 6.0E-22
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 474 593 6.0E-22
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 468 593 6.0E-22
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 450 595 6.0E-22
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 476 593 6.0E-22
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 418 588 6.0E-22
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 476 593 6.0E-22
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 457 593 6.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 459 593 7.0E-22
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 410 588 7.0E-22
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 428 593 7.0E-22
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 593 7.0E-22
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 446 591 8.0E-22
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 401 566 8.0E-22
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 396 560 8.0E-22
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 425 568 8.0E-22
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 418 593 8.0E-22
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 467 593 8.0E-22
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 449 593 8.0E-22
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 457 560 9.0E-22
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 476 593 1.0E-21
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 467 593 1.0E-21
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 467 593 1.0E-21
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 418 564 1.0E-21
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 396 588 1.0E-21
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 472 593 1.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 401 588 1.0E-21
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 479 593 1.0E-21
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 418 566 1.0E-21
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 476 593 1.0E-21
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 470 593 1.0E-21
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 418 593 1.0E-21
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 368 593 1.0E-21
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 400 562 1.0E-21
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 439 595 1.0E-21
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 457 593 1.0E-21
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 404 593 1.0E-21
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 418 596 1.0E-21
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 476 593 1.0E-21
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 437 587 1.0E-21
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 401 566 1.0E-21
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 401 562 1.0E-21
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 468 593 2.0E-21
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 468 593 2.0E-21
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 478 595 2.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 401 593 2.0E-21
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 453 593 2.0E-21
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 401 588 2.0E-21
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 368 593 2.0E-21
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 418 593 2.0E-21
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 418 593 2.0E-21
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 400 562 2.0E-21
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 418 585 2.0E-21
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 418 585 2.0E-21
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 401 568 2.0E-21
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 467 588 2.0E-21
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 457 593 2.0E-21
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 456 593 2.0E-21
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 416 561 3.0E-21
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 458 561 3.0E-21
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 568 3.0E-21
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 476 593 3.0E-21
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 472 593 3.0E-21
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 593 3.0E-21
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 418 564 3.0E-21
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 418 585 3.0E-21
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 418 585 3.0E-21
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 472 593 3.0E-21
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 476 593 4.0E-21
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 457 593 4.0E-21
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 397 593 4.0E-21
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 437 597 4.0E-21
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 401 570 4.0E-21
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 457 593 4.0E-21
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 401 566 4.0E-21
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 456 593 4.0E-21
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 396 560 5.0E-21
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 474 593 5.0E-21
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 474 593 5.0E-21
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 474 593 5.0E-21
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 474 593 5.0E-21
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 467 593 5.0E-21
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 418 598 5.0E-21
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 588 5.0E-21
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 416 559 6.0E-21
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 480 593 6.0E-21
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 478 595 6.0E-21
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 379 564 6.0E-21
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 416 564 6.0E-21
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 401 595 6.0E-21
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 472 593 6.0E-21
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 403 593 6.0E-21
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 450 593 6.0E-21
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 456 593 6.0E-21
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 478 595 7.0E-21
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 477 593 7.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 595 7.0E-21
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 396 566 7.0E-21
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 418 569 7.0E-21
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 401 561 7.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 393 593 7.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 418 593 7.0E-21
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 416 588 7.0E-21
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 361 562 8.0E-21
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 467 593 8.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 403 593 8.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 593 8.0E-21
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 418 560 8.0E-21
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 471 593 8.0E-21
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 457 593 8.0E-21
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 418 597 8.0E-21
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 416 588 8.0E-21
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 433 593 9.0E-21
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 476 588 9.0E-21
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 476 593 9.0E-21
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 451 593 1.0E-20
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 416 559 1.0E-20
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 416 559 1.0E-20
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 396 561 1.0E-20
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 378 559 1.0E-20
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 478 595 1.0E-20
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 461 595 1.0E-20
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 474 595 1.0E-20
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 474 595 1.0E-20
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 593 1.0E-20
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 418 562 1.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 418 559 1.0E-20
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 477 593 1.0E-20
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 595 1.0E-20
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 418 593 1.0E-20
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 401 588 1.0E-20
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 401 588 1.0E-20
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 418 559 1.0E-20
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 416 564 1.0E-20
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 472 593 1.0E-20
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 474 593 1.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 467 593 1.0E-20
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 456 593 1.0E-20
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 416 588 1.0E-20
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 470 595 1.0E-20
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 418 585 1.0E-20
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 418 560 1.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 440 597 1.0E-20
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 437 597 1.0E-20
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 470 593 1.0E-20
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 455 593 1.0E-20
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 457 595 1.0E-20
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 472 593 1.0E-20
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 391 593 2.0E-20
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 462 593 2.0E-20
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 465 593 2.0E-20
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 418 559 2.0E-20
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 418 564 2.0E-20
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 416 564 2.0E-20
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 469 595 2.0E-20
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 467 593 2.0E-20
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 418 585 2.0E-20
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 418 585 2.0E-20
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 476 588 2.0E-20
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 476 588 2.0E-20
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 462 593 2.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 456 597 2.0E-20
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 465 593 2.0E-20
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 593 2.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 378 559 3.0E-20
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 472 595 3.0E-20
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 472 593 3.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 458 588 3.0E-20
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 467 593 3.0E-20
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 418 585 3.0E-20
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 416 560 3.0E-20
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 418 593 3.0E-20
sp|A8MUV8|ZN727_HUMAN Putative zinc finger protein 727 OS=Homo sapiens GN=ZNF727 PE=5 SV=3 401 563 3.0E-20
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 401 588 3.0E-20
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 418 593 3.0E-20
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 470 588 3.0E-20
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 418 593 3.0E-20
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 481 593 4.0E-20
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 418 593 4.0E-20
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 401 564 4.0E-20
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 473 595 4.0E-20
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 476 593 4.0E-20
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 449 593 4.0E-20
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 449 593 4.0E-20
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 359 593 4.0E-20
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 418 593 4.0E-20
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 462 593 4.0E-20
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 458 593 4.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 471 593 5.0E-20
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 416 564 5.0E-20
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 396 575 5.0E-20
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 418 566 5.0E-20
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 475 593 5.0E-20
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 457 564 5.0E-20
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 456 587 6.0E-20
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 418 587 6.0E-20
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 478 593 6.0E-20
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 408 565 6.0E-20
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 418 592 6.0E-20
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 455 593 6.0E-20
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 465 593 6.0E-20
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 401 592 6.0E-20
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 393 562 6.0E-20
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 398 593 6.0E-20
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 482 595 7.0E-20
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 472 593 7.0E-20
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 397 568 7.0E-20
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 457 564 7.0E-20
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 418 593 7.0E-20
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 478 595 8.0E-20
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 476 593 8.0E-20
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 471 593 8.0E-20
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 473 593 9.0E-20
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 418 562 9.0E-20
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 474 595 9.0E-20
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 476 593 9.0E-20
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 457 564 9.0E-20
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 406 593 9.0E-20
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 503 593 1.0E-19
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 378 575 1.0E-19
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 500 593 1.0E-19
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 437 593 1.0E-19
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 465 593 1.0E-19
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 457 562 1.0E-19
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 459 593 1.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 418 593 1.0E-19
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 457 593 1.0E-19
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 418 560 1.0E-19
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 474 593 1.0E-19
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 436 588 1.0E-19
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 456 593 2.0E-19
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 401 561 2.0E-19
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 399 582 2.0E-19
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 468 593 2.0E-19
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 472 595 2.0E-19
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 418 564 2.0E-19
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 476 593 2.0E-19
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 465 588 2.0E-19
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 418 556 2.0E-19
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 419 593 2.0E-19
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 476 593 2.0E-19
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 418 566 2.0E-19
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 457 593 2.0E-19
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 418 562 2.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 476 593 2.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 457 588 2.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 396 588 2.0E-19
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 418 559 2.0E-19
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 418 564 2.0E-19
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 459 595 2.0E-19
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 418 562 2.0E-19
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 457 569 2.0E-19
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 457 559 2.0E-19
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 456 593 3.0E-19
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 401 581 3.0E-19
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 470 593 3.0E-19
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 401 581 3.0E-19
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 472 593 3.0E-19
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 401 559 3.0E-19
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 401 560 3.0E-19
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 480 593 3.0E-19
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 401 598 3.0E-19
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 401 590 3.0E-19
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 418 559 3.0E-19
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 418 560 3.0E-19
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 418 558 3.0E-19
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 418 562 4.0E-19
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 475 593 4.0E-19
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 465 565 4.0E-19
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 457 593 4.0E-19
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 593 4.0E-19
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 457 593 4.0E-19
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 457 595 5.0E-19
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 437 562 5.0E-19
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 457 593 5.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 452 593 6.0E-19
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 396 593 6.0E-19
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 486 593 6.0E-19
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 476 593 6.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 465 593 6.0E-19
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 378 558 7.0E-19
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 401 559 7.0E-19
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 378 558 7.0E-19
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 378 558 7.0E-19
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 467 593 7.0E-19
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 468 593 7.0E-19
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 416 588 7.0E-19
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 406 595 7.0E-19
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 457 593 7.0E-19
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 418 593 7.0E-19
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 378 558 8.0E-19
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 378 558 8.0E-19
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 593 8.0E-19
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 418 588 8.0E-19
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 401 559 9.0E-19
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 418 560 9.0E-19
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 418 584 9.0E-19
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 416 593 9.0E-19
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 401 561 9.0E-19
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 492 593 1.0E-18
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 416 560 1.0E-18
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 476 593 1.0E-18
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 378 558 1.0E-18
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 378 558 1.0E-18
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 474 593 1.0E-18
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 418 593 1.0E-18
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 418 559 1.0E-18
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 418 593 1.0E-18
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 501 593 1.0E-18
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 418 593 1.0E-18
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 457 562 1.0E-18
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 453 593 1.0E-18
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 418 568 1.0E-18
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 406 595 1.0E-18
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 418 556 1.0E-18
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 470 593 1.0E-18
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 418 562 2.0E-18
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 477 588 2.0E-18
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 468 593 2.0E-18
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 457 592 2.0E-18
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 467 593 2.0E-18
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 486 593 2.0E-18
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 401 559 2.0E-18
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 457 593 2.0E-18
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 457 593 2.0E-18
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 401 593 2.0E-18
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 476 593 2.0E-18
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 478 598 2.0E-18
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 468 588 2.0E-18
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 457 591 2.0E-18
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 414 593 2.0E-18
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 418 593 2.0E-18
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 460 588 2.0E-18
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 593 2.0E-18
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 418 564 3.0E-18
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 488 593 3.0E-18
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 374 588 3.0E-18
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 418 560 3.0E-18
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 477 593 3.0E-18
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 401 561 3.0E-18
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 418 562 3.0E-18
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 418 593 3.0E-18
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 497 593 4.0E-18
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 472 593 4.0E-18
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 440 593 4.0E-18
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 418 564 4.0E-18
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 474 593 4.0E-18
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 418 588 4.0E-18
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 497 593 4.0E-18
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 476 593 4.0E-18
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 479 593 5.0E-18
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 432 559 5.0E-18
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 432 559 5.0E-18
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 593 5.0E-18
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 450 588 5.0E-18
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 400 566 5.0E-18
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 418 558 5.0E-18
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 466 593 6.0E-18
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 396 566 6.0E-18
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 478 593 6.0E-18
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 415 559 6.0E-18
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 472 593 6.0E-18
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 480 593 6.0E-18
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 399 566 7.0E-18
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 418 561 7.0E-18
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 418 561 7.0E-18
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 418 561 7.0E-18
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 378 564 7.0E-18
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 478 598 7.0E-18
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 418 562 8.0E-18
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 450 588 8.0E-18
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 418 561 8.0E-18
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 437 593 8.0E-18
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 443 593 8.0E-18
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 418 558 8.0E-18
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 409 594 8.0E-18
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 502 593 9.0E-18
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 487 593 9.0E-18
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 404 558 9.0E-18
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 418 565 9.0E-18
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 465 593 1.0E-17
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 379 558 1.0E-17
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 401 593 1.0E-17
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 418 559 1.0E-17
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 458 595 1.0E-17
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 418 559 1.0E-17
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 404 558 1.0E-17
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 473 595 1.0E-17
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 416 588 1.0E-17
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 468 593 1.0E-17
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 455 593 1.0E-17
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 424 587 1.0E-17
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 476 593 1.0E-17
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 418 560 2.0E-17
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 476 593 2.0E-17
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 457 564 2.0E-17
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 418 593 2.0E-17
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 476 593 2.0E-17
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 457 564 2.0E-17
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 484 593 2.0E-17
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 455 593 2.0E-17
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 470 593 2.0E-17
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 465 595 3.0E-17
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 416 559 3.0E-17
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 504 593 3.0E-17
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 418 582 3.0E-17
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 504 593 3.0E-17
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 418 561 3.0E-17
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 457 588 3.0E-17
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 476 593 3.0E-17
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 399 558 3.0E-17
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 467 588 3.0E-17
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 401 558 3.0E-17
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 372 562 3.0E-17
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 401 558 4.0E-17
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 470 593 4.0E-17
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 418 560 4.0E-17
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 471 593 4.0E-17
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 399 558 4.0E-17
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 418 570 4.0E-17
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 418 568 5.0E-17
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 456 593 6.0E-17
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 457 561 6.0E-17
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 457 588 6.0E-17
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 494 593 6.0E-17
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 485 593 6.0E-17
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 401 558 6.0E-17
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 491 593 6.0E-17
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 377 558 7.0E-17
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 457 597 7.0E-17
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 401 561 7.0E-17
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 418 558 7.0E-17
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 401 560 7.0E-17
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 457 593 8.0E-17
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 418 560 8.0E-17
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 418 562 8.0E-17
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 457 568 8.0E-17
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 418 582 1.0E-16
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 487 595 1.0E-16
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 474 593 1.0E-16
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 457 561 1.0E-16
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 478 593 1.0E-16
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 477 593 1.0E-16
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 454 593 2.0E-16
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 457 559 2.0E-16
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 396 558 2.0E-16
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 438 593 2.0E-16
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 416 564 2.0E-16
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 401 558 2.0E-16
sp|E7ETH6|Z587B_HUMAN Zinc finger protein 587B OS=Homo sapiens GN=ZNF587B PE=1 SV=1 457 593 2.0E-16
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 478 595 2.0E-16
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 473 588 2.0E-16
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 396 575 2.0E-16
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 498 593 3.0E-16
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 498 593 3.0E-16
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 487 593 3.0E-16
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 465 593 3.0E-16
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 482 593 3.0E-16
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 418 561 3.0E-16
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 418 593 3.0E-16
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 359 593 4.0E-16
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 503 593 4.0E-16
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 401 562 5.0E-16
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 456 593 5.0E-16
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 476 593 5.0E-16
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 487 593 6.0E-16
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 458 593 6.0E-16
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 493 593 6.0E-16
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 458 593 6.0E-16
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 480 588 7.0E-16
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 418 559 7.0E-16
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 418 564 7.0E-16
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 447 593 7.0E-16
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 472 593 8.0E-16
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 503 593 8.0E-16
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 418 593 8.0E-16
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 391 530 8.0E-16
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 488 593 8.0E-16
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 457 559 8.0E-16
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 468 593 9.0E-16
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 486 593 9.0E-16
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 470 593 9.0E-16
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 401 565 9.0E-16
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 502 595 1.0E-15
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 503 593 1.0E-15
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 418 582 1.0E-15
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 401 561 1.0E-15
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 495 595 1.0E-15
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 457 560 1.0E-15
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 401 565 1.0E-15
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 457 561 1.0E-15
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 391 551 2.0E-15
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 418 537 2.0E-15
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 401 568 2.0E-15
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 457 592 2.0E-15
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 418 581 2.0E-15
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 457 573 2.0E-15
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 476 593 2.0E-15
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 501 595 2.0E-15
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 352 593 2.0E-15
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 400 562 2.0E-15
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 396 561 3.0E-15
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 459 593 3.0E-15
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 418 576 3.0E-15
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 391 530 3.0E-15
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 457 556 3.0E-15
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 457 556 3.0E-15
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 473 593 3.0E-15
sp|E7ETH6|Z587B_HUMAN Zinc finger protein 587B OS=Homo sapiens GN=ZNF587B PE=1 SV=1 457 593 3.0E-15
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 496 593 4.0E-15
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 476 593 4.0E-15
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 457 556 4.0E-15
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 388 588 4.0E-15
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 457 593 4.0E-15
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 418 581 5.0E-15
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 481 593 5.0E-15
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 457 593 5.0E-15
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 457 556 5.0E-15
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 513 593 5.0E-15
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 416 593 5.0E-15
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 395 561 6.0E-15
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 418 545 6.0E-15
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 456 593 7.0E-15
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 391 564 7.0E-15
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 459 588 7.0E-15
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 502 593 7.0E-15
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 502 593 7.0E-15
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 459 593 7.0E-15
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 513 595 8.0E-15
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 487 593 8.0E-15
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 412 592 8.0E-15
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 476 593 9.0E-15
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 499 593 9.0E-15
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 481 593 9.0E-15
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 503 593 1.0E-14
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 416 561 1.0E-14
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 487 595 1.0E-14
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 502 593 1.0E-14
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 393 530 1.0E-14
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 500 593 1.0E-14
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 504 595 1.0E-14
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 485 593 1.0E-14
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 502 593 2.0E-14
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 416 538 2.0E-14
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 472 595 2.0E-14
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 593 2.0E-14
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 457 556 2.0E-14
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 451 588 2.0E-14
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 511 595 2.0E-14
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 511 595 2.0E-14
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 470 588 2.0E-14
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 501 593 2.0E-14
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 418 545 2.0E-14
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 457 556 2.0E-14
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 393 530 2.0E-14
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 473 593 2.0E-14
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 470 593 2.0E-14
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 495 595 2.0E-14
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 391 564 2.0E-14
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 418 556 3.0E-14
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 474 593 3.0E-14
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 511 595 3.0E-14
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 439 561 3.0E-14
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 504 593 3.0E-14
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 465 593 3.0E-14
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 418 545 3.0E-14
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 457 556 3.0E-14
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 457 556 3.0E-14
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 391 530 3.0E-14
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 474 593 4.0E-14
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 484 593 4.0E-14
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 505 593 4.0E-14
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 511 595 4.0E-14
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 418 588 4.0E-14
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 450 593 5.0E-14
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 486 593 5.0E-14
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 418 559 5.0E-14
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 484 593 6.0E-14
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 473 593 6.0E-14
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 416 558 6.0E-14
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 410 558 6.0E-14
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 418 595 7.0E-14
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 497 593 7.0E-14
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 455 593 7.0E-14
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 482 593 7.0E-14
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 491 588 7.0E-14
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 391 542 8.0E-14
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 454 588 8.0E-14
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 401 558 1.0E-13
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 508 593 1.0E-13
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 457 593 1.0E-13
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 340 593 1.0E-13
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 401 531 1.0E-13
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 418 553 1.0E-13
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 508 593 1.0E-13
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 513 592 1.0E-13
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 447 588 1.0E-13
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 470 593 1.0E-13
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 455 593 2.0E-13
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 450 593 2.0E-13
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 450 593 2.0E-13
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 476 593 2.0E-13
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 459 593 2.0E-13
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 498 592 2.0E-13
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 470 593 2.0E-13
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 498 592 2.0E-13
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 455 593 3.0E-13
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 514 595 3.0E-13
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 511 595 3.0E-13
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 418 561 3.0E-13
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 457 588 3.0E-13
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 457 588 3.0E-13
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 513 593 3.0E-13
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 465 593 3.0E-13
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 467 588 3.0E-13
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 505 593 4.0E-13
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 511 595 4.0E-13
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 399 540 4.0E-13
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 396 537 4.0E-13
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 476 588 4.0E-13
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 504 593 5.0E-13
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 476 593 5.0E-13
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 476 593 6.0E-13
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 371 533 6.0E-13
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 456 588 6.0E-13
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 511 595 6.0E-13
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 429 593 6.0E-13
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 377 560 7.0E-13
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 486 593 7.0E-13
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 476 593 8.0E-13
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 418 562 8.0E-13
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 506 588 8.0E-13
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 513 593 9.0E-13
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 506 588 9.0E-13
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 418 558 1.0E-12
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 401 582 1.0E-12
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 507 595 1.0E-12
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 418 537 1.0E-12
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 487 593 1.0E-12
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 461 592 1.0E-12
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 393 588 1.0E-12
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 469 597 2.0E-12
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 476 593 2.0E-12
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 371 533 2.0E-12
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 467 593 2.0E-12
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 478 593 3.0E-12
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 508 593 3.0E-12
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 416 533 3.0E-12
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 418 545 3.0E-12
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 476 593 3.0E-12
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 396 537 3.0E-12
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 418 566 3.0E-12
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 416 593 3.0E-12
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 416 533 4.0E-12
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 498 593 4.0E-12
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 498 593 4.0E-12
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 418 537 4.0E-12
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 468 597 4.0E-12
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 418 537 4.0E-12
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 496 595 4.0E-12
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 468 593 5.0E-12
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 418 593 5.0E-12
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 457 593 5.0E-12
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 497 588 5.0E-12
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 478 593 6.0E-12
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 406 537 7.0E-12
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 406 537 7.0E-12
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 391 593 7.0E-12
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 406 537 8.0E-12
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 418 530 9.0E-12
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 469 593 1.0E-11
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 416 532 1.0E-11
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 588 1.0E-11
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 403 533 1.0E-11
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 501 591 1.0E-11
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 418 551 1.0E-11
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 396 552 1.0E-11
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 418 537 1.0E-11
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 416 537 2.0E-11
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 414 593 2.0E-11
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 428 593 2.0E-11
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 495 593 2.0E-11
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 501 595 2.0E-11
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 453 597 2.0E-11
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 416 570 2.0E-11
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 396 562 2.0E-11
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 469 559 2.0E-11
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 501 595 2.0E-11
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 472 593 2.0E-11
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 418 588 2.0E-11
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 418 542 3.0E-11
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 418 536 3.0E-11
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 416 534 3.0E-11
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 416 534 3.0E-11
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 451 588 3.0E-11
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 478 588 3.0E-11
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 478 593 4.0E-11
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 398 561 4.0E-11
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 505 595 5.0E-11
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 479 593 5.0E-11
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 418 534 5.0E-11
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 425 592 5.0E-11
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 529 593 5.0E-11
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 501 593 5.0E-11
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 403 533 6.0E-11
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 456 588 6.0E-11
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 397 531 7.0E-11
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 504 595 7.0E-11
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 457 536 7.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 523 593 8.0E-11
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 504 595 8.0E-11
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 486 593 9.0E-11
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 476 593 9.0E-11
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 457 588 1.0E-10
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 501 593 1.0E-10
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 418 536 1.0E-10
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 406 551 1.0E-10
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 509 593 1.0E-10
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 522 593 1.0E-10
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 501 593 2.0E-10
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 473 593 2.0E-10
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 416 537 2.0E-10
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 416 537 2.0E-10
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 504 591 2.0E-10
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 473 588 2.0E-10
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 523 593 2.0E-10
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 418 534 2.0E-10
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 418 532 3.0E-10
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 474 593 3.0E-10
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 500 595 3.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 474 594 3.0E-10
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 457 588 3.0E-10
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 476 593 3.0E-10
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 392 536 4.0E-10
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 501 588 4.0E-10
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 514 593 4.0E-10
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 501 588 4.0E-10
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 454 593 4.0E-10
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 478 593 4.0E-10
sp|Q8N393|ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens GN=ZNF786 PE=2 SV=2 418 530 5.0E-10
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 499 597 5.0E-10
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 516 593 6.0E-10
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 378 531 7.0E-10
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 515 593 8.0E-10
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 401 537 8.0E-10
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 509 593 8.0E-10
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 474 593 8.0E-10
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 391 531 9.0E-10
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 418 531 1.0E-09
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 529 595 1.0E-09
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 432 593 1.0E-09
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 416 551 1.0E-09
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 391 531 1.0E-09
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 500 588 1.0E-09
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 510 593 1.0E-09
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 470 588 2.0E-09
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 406 537 2.0E-09
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 527 593 2.0E-09
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 501 593 2.0E-09
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 474 593 2.0E-09
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 484 591 2.0E-09
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 476 588 2.0E-09
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 512 593 2.0E-09
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 512 593 2.0E-09
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 476 568 2.0E-09
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 418 530 2.0E-09
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 533 593 3.0E-09
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 419 593 3.0E-09
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 455 593 3.0E-09
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 478 595 3.0E-09
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 503 586 3.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 397 539 4.0E-09
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 416 592 5.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 459 588 6.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 526 593 6.0E-09
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 473 584 6.0E-09
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 457 537 7.0E-09
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 388 534 7.0E-09
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 516 593 9.0E-09
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 418 528 9.0E-09
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 418 528 9.0E-09
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 454 587 9.0E-09
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 396 528 1.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 534 593 1.0E-08
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 513 593 1.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 416 537 1.0E-08
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 439 593 1.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 502 595 1.0E-08
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 526 593 1.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 495 588 1.0E-08
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 499 593 1.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 478 595 1.0E-08
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 493 593 1.0E-08
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 471 588 1.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 490 593 1.0E-08
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 524 593 2.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 488 588 2.0E-08
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 406 537 2.0E-08
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 457 584 2.0E-08
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 401 565 2.0E-08
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 463 593 2.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 478 595 2.0E-08
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 478 559 2.0E-08
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 418 537 3.0E-08
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 529 593 3.0E-08
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 437 588 3.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 482 591 3.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 518 593 4.0E-08
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 513 588 5.0E-08
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 457 593 5.0E-08
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 487 593 5.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 533 593 6.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 531 593 6.0E-08
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 524 593 7.0E-08
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 514 595 7.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 401 595 8.0E-08
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 401 531 1.0E-07
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 510 593 1.0E-07
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 527 593 1.0E-07
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 476 593 1.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 495 588 2.0E-07
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 378 535 2.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 468 593 2.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 509 588 3.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 503 593 3.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 516 593 3.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 512 593 3.0E-07
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 528 593 3.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 525 593 4.0E-07
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 457 598 4.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 396 507 5.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 420 593 6.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 516 593 6.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 525 593 6.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 524 593 6.0E-07
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 531 593 6.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 459 588 7.0E-07
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 513 593 7.0E-07
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 513 593 7.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 516 593 7.0E-07
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 527 593 8.0E-07
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 513 593 8.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 513 593 8.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 419 593 8.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 468 588 1.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 443 593 1.0E-06
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 513 593 1.0E-06
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 513 593 1.0E-06
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 513 593 1.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 534 595 1.0E-06
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 500 595 1.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 514 593 1.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 501 588 1.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 378 535 1.0E-06
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 418 533 1.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 525 593 2.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 525 593 2.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 525 593 2.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 418 532 2.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 537 593 2.0E-06
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 391 531 2.0E-06
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 538 593 2.0E-06
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 525 593 2.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 457 553 2.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 452 593 2.0E-06
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 533 595 3.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 472 593 3.0E-06
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 457 526 3.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 476 562 4.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 527 593 4.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 515 593 5.0E-06
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 394 548 5.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 457 595 6.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 476 593 6.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 469 593 7.0E-06
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 495 593 7.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 476 558 8.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 468 532 8.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 527 588 9.0E-06
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 394 548 9.0E-06
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 459 593 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093610
MQQSAATHRISQQWTSASKCGYSFPSPCADCPEPSCSTSDELTSLCTDQCIVIACTDPEHRPNTLTRCDLGYDNA
TPLCLDCDEIQNFLQCCDSLDNCYVDHPRSARPPHQAQVQRGRGHDDWDAALTAALCNCEHMSELHSIYPSTTST
SSSPHDGSSRSTQPPLTPAPSCSLAHPYTSISQPYSSVVPTEAQQLGDSPYTEPQDQQQVTHAGSSTTAPLTCMW
GNCQMQFQSLAELVGHVNLAHLCNHSEHSGSQTNYPTPPAQNCDNKMPCLWGDCTENLMPPFSPGGATLSEFVNH
LFQDHLGLHPSHFDGQYGDLQVDRMLAEMATPQHSEQNQFQAPQQVPYGPGVADSTNVGNLNTAAQKSSEDEANL
SISPRDASSSTTSSPRTVASTISSVISVGETPKNDHVCLWNGCMKSFETCNDLMTHISAAHVGSGKPRYDCLWEG
CMRNGDKGFSSKQKICRHLQSHTGYRPFQCPDCLQNFSEAATLQQHRRRHTQEKPYKCDFPGCGKSFAITGALTI
HKRVHNGQKPFKCTYCGRGFAESSNLSKHLRTHTGERPYVCPEPECSKAFARPDQLTRHMNVHRNKEPEIAVS*
Coding >AgabiH97|093610
ATGCAGCAGTCTGCAGCCACTCACCGCATCTCCCAGCAGTGGACGTCAGCCTCAAAGTGCGGTTACTCATTTCCC
AGCCCATGCGCAGACTGCCCCGAGCCATCGTGCTCAACCTCTGACGAGCTTACATCCCTCTGCACTGACCAATGT
ATCGTCATCGCCTGTACAGATCCAGAACACCGTCCCAACACCCTTACCCGCTGCGATCTTGGCTACGATAATGCC
ACGCCCCTCTGCCTAGACTGTGACGAGATACAGAATTTTCTCCAGTGTTGTGATAGTCTGGATAATTGTTATGTT
GACCACCCTCGATCAGCACGCCCTCCACACCAGGCGCAAGTCCAACGAGGCAGAGGCCATGATGACTGGGATGCT
GCGCTAACTGCCGCACTCTGTAATTGCGAACACATGTCGGAGTTGCACAGTATCTATCCGTCAACAACATCAACG
TCATCCTCGCCTCATGACGGTTCTTCTCGAAGTACTCAGCCCCCGCTCACACCAGCTCCTTCTTGTTCTTTAGCC
CACCCCTATACATCGATTTCTCAGCCATACTCATCCGTCGTGCCGACGGAGGCCCAACAATTAGGAGATAGTCCC
TACACTGAGCCGCAGGACCAGCAGCAGGTCACTCATGCAGGGTCATCCACGACCGCCCCCTTAACGTGCATGTGG
GGGAATTGTCAAATGCAATTTCAATCACTTGCTGAGCTCGTCGGACACGTCAATCTTGCTCATCTCTGCAATCAC
TCGGAACATTCGGGTAGCCAGACAAACTATCCTACTCCCCCTGCTCAGAACTGTGACAATAAGATGCCTTGCCTT
TGGGGTGACTGTACTGAAAATCTCATGCCACCGTTTTCACCTGGAGGTGCCACATTGTCTGAGTTTGTCAATCAT
CTATTTCAAGATCATCTGGGCTTGCACCCTTCCCACTTTGATGGACAGTACGGTGATCTCCAAGTTGATCGTATG
CTGGCCGAAATGGCGACGCCCCAGCACTCGGAGCAGAATCAATTTCAAGCACCGCAGCAGGTCCCGTACGGACCG
GGGGTCGCAGATTCCACTAATGTTGGGAACCTGAACACGGCGGCACAGAAAAGTAGCGAGGACGAAGCCAATCTT
TCAATTTCGCCGCGGGATGCGAGCAGCTCTACTACATCTTCGCCTCGAACCGTAGCATCGACCATCAGTTCTGTT
ATATCCGTTGGAGAAACACCTAAAAACGACCACGTATGCTTATGGAATGGATGTATGAAATCGTTTGAAACTTGC
AACGATTTGATGACCCATATATCCGCTGCACATGTTGGGAGTGGGAAACCTCGATATGACTGTTTGTGGGAAGGG
TGCATGAGGAATGGAGACAAAGGCTTTTCGAGTAAACAAAAGATTTGCCGGCACTTACAGTCACACACGGGCTAT
AGACCGTTTCAGTGTCCTGATTGTTTACAGAATTTTTCAGAGGCGGCAACTTTGCAGCAACACCGACGAAGACAT
ACTCAAGAAAAACCTTATAAATGTGATTTTCCTGGTTGTGGAAAGTCGTTTGCAATCACCGGGGCACTTACTATT
CACAAACGAGTACATAACGGGCAAAAACCTTTCAAATGCACATATTGTGGCAGAGGCTTCGCAGAATCCTCCAAT
CTATCCAAACATCTGCGTACTCACACTGGAGAAAGACCATACGTCTGTCCTGAACCTGAATGTAGCAAAGCATTT
GCACGTCCGGACCAACTCACTCGGCATATGAATGTGCATCGTAATAAAGAACCGGAAATCGCGGTTTCATGA
Transcript >AgabiH97|093610
ATGCAGCAGTCTGCAGCCACTCACCGCATCTCCCAGCAGTGGACGTCAGCCTCAAAGTGCGGTTACTCATTTCCC
AGCCCATGCGCAGACTGCCCCGAGCCATCGTGCTCAACCTCTGACGAGCTTACATCCCTCTGCACTGACCAATGT
ATCGTCATCGCCTGTACAGATCCAGAACACCGTCCCAACACCCTTACCCGCTGCGATCTTGGCTACGATAATGCC
ACGCCCCTCTGCCTAGACTGTGACGAGATACAGAATTTTCTCCAGTGTTGTGATAGTCTGGATAATTGTTATGTT
GACCACCCTCGATCAGCACGCCCTCCACACCAGGCGCAAGTCCAACGAGGCAGAGGCCATGATGACTGGGATGCT
GCGCTAACTGCCGCACTCTGTAATTGCGAACACATGTCGGAGTTGCACAGTATCTATCCGTCAACAACATCAACG
TCATCCTCGCCTCATGACGGTTCTTCTCGAAGTACTCAGCCCCCGCTCACACCAGCTCCTTCTTGTTCTTTAGCC
CACCCCTATACATCGATTTCTCAGCCATACTCATCCGTCGTGCCGACGGAGGCCCAACAATTAGGAGATAGTCCC
TACACTGAGCCGCAGGACCAGCAGCAGGTCACTCATGCAGGGTCATCCACGACCGCCCCCTTAACGTGCATGTGG
GGGAATTGTCAAATGCAATTTCAATCACTTGCTGAGCTCGTCGGACACGTCAATCTTGCTCATCTCTGCAATCAC
TCGGAACATTCGGGTAGCCAGACAAACTATCCTACTCCCCCTGCTCAGAACTGTGACAATAAGATGCCTTGCCTT
TGGGGTGACTGTACTGAAAATCTCATGCCACCGTTTTCACCTGGAGGTGCCACATTGTCTGAGTTTGTCAATCAT
CTATTTCAAGATCATCTGGGCTTGCACCCTTCCCACTTTGATGGACAGTACGGTGATCTCCAAGTTGATCGTATG
CTGGCCGAAATGGCGACGCCCCAGCACTCGGAGCAGAATCAATTTCAAGCACCGCAGCAGGTCCCGTACGGACCG
GGGGTCGCAGATTCCACTAATGTTGGGAACCTGAACACGGCGGCACAGAAAAGTAGCGAGGACGAAGCCAATCTT
TCAATTTCGCCGCGGGATGCGAGCAGCTCTACTACATCTTCGCCTCGAACCGTAGCATCGACCATCAGTTCTGTT
ATATCCGTTGGAGAAACACCTAAAAACGACCACGTATGCTTATGGAATGGATGTATGAAATCGTTTGAAACTTGC
AACGATTTGATGACCCATATATCCGCTGCACATGTTGGGAGTGGGAAACCTCGATATGACTGTTTGTGGGAAGGG
TGCATGAGGAATGGAGACAAAGGCTTTTCGAGTAAACAAAAGATTTGCCGGCACTTACAGTCACACACGGGCTAT
AGACCGTTTCAGTGTCCTGATTGTTTACAGAATTTTTCAGAGGCGGCAACTTTGCAGCAACACCGACGAAGACAT
ACTCAAGAAAAACCTTATAAATGTGATTTTCCTGGTTGTGGAAAGTCGTTTGCAATCACCGGGGCACTTACTATT
CACAAACGAGTACATAACGGGCAAAAACCTTTCAAATGCACATATTGTGGCAGAGGCTTCGCAGAATCCTCCAAT
CTATCCAAACATCTGCGTACTCACACTGGAGAAAGACCATACGTCTGTCCTGAACCTGAATGTAGCAAAGCATTT
GCACGTCCGGACCAACTCACTCGGCATATGAATGTGCATCGTAATAAAGAACCGGAAATCGCGGTTTCATGA
Gene >AgabiH97|093610
ATGCAGCAGTCTGCAGCCACTCACCGCATCTCCCAGCAGTGGACGTCAGCCTCAAAGTGCGGTTACTCATTTCCC
AGCCCATGCGCAGACTGCCCCGAGCCATCGTGCTCAACCTCTGACGAGCTTACATCCCTCTGCACTGACCAATGT
ATCGTCATCGCCTGTACAGATCCAGAACACCGTCCCAACACCCTTACCCGCTGCGATCTTGGCTACGATAATGCC
ACGCCCCTCTGCCTAGACTGTGACGAGATACAGAATTTTGTAAGTTGGGTGGATCCCATCAGTTGAATTGAATGC
ATGTCGTTAACCACGTTGGCCAGCTCCAGTGTTGTGATAGTCTGGATAATTGTTATGTTGACCACCCTCGATCAG
CACGCCCTCCACACCAGGCGCAAGTCCAACGAGGCAGAGGCCATGATGACTGGGATGCTGCGCTAACTGCCGCAC
TCTGTAATTGCGAACACATGTCGGAGTTGCACAGTATCTATCCGTCAACAACATCAACGTCATCCTCGCCTCATG
ACGGTTCTTCTCGAAGTACTCAGCCCCCGCTCACACCAGCTCCTTCTTGTTCTTTAGCCCACCCCTATACATCGA
TTTCTCAGCCATACTCATCCGTCGTGCCGACGGAGGCCCAACAATTAGGAGATAGTCCCTACACTGAGCCGCAGG
ACCAGCAGCAGGTCACTCATGCAGGGTCATCCACGACCGCCCCCTTAACGTGCATGTGGGGGAATTGTCAAATGC
AATTTCAATCACTTGCTGAGCTCGTCGGACACGTCAATCTTGCTCATCTCTGCAATCACTCGGAACATTCGGGTA
GCCAGACAAACTATCCTACTCCCCCTGCTCAGAACTGTGACAATAAGATGCCTTGCCTTTGGGGTGACTGTACTG
AAAATCTCATGCCACCGTTTTCACCTGGAGGTGCCACATTGTCTGAGTTTGTCAATCATCTATTTCAAGATCATC
TGGGCTTGCACCCTTCCCACTTTGATGGACAGTACGGTGATCTCCAAGTTGATCGTATGCTGGCCGAAATGGCGA
CGCCCCAGCACTCGGAGCAGAATCAATTTCAAGCACCGCAGCAGGTCCCGTACGGACCGGGGGTCGCAGATTCCA
CTAATGTTGGGAACCTGAACACGGCGGCACAGAAAAGTAGCGAGGACGAAGCCAATCTTTCAATTTCGCCGCGGG
ATGCGAGCAGCTCTACTACATCTTCGCCTCGAACCGTAGCATCGACCATCAGTTCTGTTATATCCGTTGGAGAAA
CACCTAAAAACGACCACGTATGCTTATGGAATGGATGTATGAAATCGTTTGAAACTTGCAACGATTTGATGACCC
ATATATCCGCTGCACATGTTGGGAGTGGGAAACCTCGATATGACTGTTTGTGGGAAGGGTGCATGAGGAATGGAG
ACAAAGGCTTTTCGAGTAAACAAAAGATTTGCCGGCACTTACAGGTATTAACTTTGTCTTTCTCAGCTTGACCGG
GGTGCTGATATAGACCTTCCTCAGTCACACACGGGCTATAGACCGTTTCAGTGTCCTGATTGTTTACAGAATTTT
TCAGAGGCGGCAACTTTGCAGCAACACCGACGAAGACATACTCAAGAAAGTGAGTAATAGTATTCTTTTCTTTTG
ACCTCGCAAATGAATGTCTTCGAATAATTAGAACCTTATAAATGTGATTTTCCTGGTTGTGGAAAGTCGTTTGCA
ATCACCGGGGCACTTACTATTCACAAACGAGTACATAACGGGCAAAAACCTTTCAAATGCACATATTGTGGCAGG
TGCGTAGACGAAGCCCCTCAGGGTTTTGAGCCTTTAGACTCATTAATTTTCATAAAACAGAGGCTTCGCAGAATC
CTCCAATCTATCCAAACATGTGAGAGCCATTTGATTGTTCATGTGAAAATTAAAGCGCTCATATATGTTCGTTCA
TAGCTGCGTACTCACACTGGAGAAAGACCATACGTCTGTCCTGAACCTGAATGTAGCAAAGCATTTGCACGTCCG
GACCAACTCACTCGGCATATGAATGTGCATCGTAATAAAGAACCGGAAATCGCGGTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail