Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093590
Gene name
Locationscaffold_6:1381474..1382425
Strand+
Gene length (bp)951
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00276 Ribosomal_L23 Ribosomal protein L23 5.3E-09 143 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09727|MRP20_SCHPO 54S ribosomal protein L23, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp20 PE=3 SV=1 119 214 2.0E-07
sp|P32387|RM41_YEAST 54S ribosomal protein L41, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP20 PE=1 SV=1 104 208 3.0E-07

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093590
MQSLCRSLSSLRLYSTKPPRPVPDGALSARTASTPLAVRLRRDKKFGPTQPGADDATADGLTPTDNARYRRHLAL
DLIPKKGGVPLSPAEWISLRNSRRSRLRGVRGGPEELRVVGQPVYLPNVIFRLVRNHTPPGEPYNPYEATFRIPH
SVTKTDIRSYLLAVYGVKTTYIRTDNYFAPVPNRGRARQTYKSYKRAVVGLVDPFYYPHRLEDMPLEKREEREKW
LESKLRLQENKQLRKEQLLRVSKGTVLKAPNVTKRSHILKLVAERRQKREELVSQIAGEWKDMREQGEKIVWPEN
PIARDSAVPAVTESSS*
Coding >AgabiH97|093590
ATGCAGTCTCTCTGCCGCTCCCTTTCGTCTCTCCGTCTCTATTCCACAAAGCCGCCGCGACCCGTCCCAGACGGT
GCTCTCTCTGCCAGAACAGCGTCTACTCCTCTCGCCGTTCGCCTCCGTCGCGACAAAAAATTCGGTCCTACCCAG
CCCGGCGCAGACGATGCCACGGCCGACGGCCTGACTCCCACCGACAATGCCCGCTACCGACGCCATCTTGCCTTG
GACCTCATTCCAAAGAAGGGCGGCGTCCCTCTTTCTCCTGCAGAGTGGATAAGTTTGCGCAACAGTCGGAGATCC
CGTCTGCGCGGTGTCAGAGGCGGACCAGAGGAACTTCGTGTTGTGGGGCAACCTGTGTATCTTCCCAACGTCATA
TTCCGTCTCGTTCGAAATCACACTCCTCCCGGTGAACCCTACAACCCTTATGAAGCCACCTTCCGTATCCCGCAC
TCCGTCACGAAGACCGATATACGCTCCTACCTTCTCGCTGTATATGGCGTCAAAACCACATATATCCGCACAGAC
AACTACTTTGCACCCGTCCCCAATAGAGGTCGAGCCCGCCAGACGTACAAATCCTATAAACGTGCTGTTGTCGGT
TTGGTTGACCCATTCTACTACCCACACCGTCTAGAAGATATGCCTCTAGAAAAACGGGAGGAACGTGAAAAGTGG
CTCGAAAGCAAACTCCGGTTGCAGGAGAACAAACAACTACGAAAGGAACAATTGTTGCGCGTCAGCAAGGGAACA
GTACTCAAGGCTCCCAACGTCACGAAGCGCTCGCATATCTTGAAGCTTGTTGCAGAGCGGAGGCAGAAGAGGGAA
GAACTGGTTTCTCAGATTGCTGGTGAATGGAAGGATATGAGAGAACAGGGAGAGAAGATCGTTTGGCCAGAAAAC
CCGATAGCCAGAGACTCTGCTGTACCTGCGGTAACAGAATCCTCTTCGTAA
Transcript >AgabiH97|093590
ATGCAGTCTCTCTGCCGCTCCCTTTCGTCTCTCCGTCTCTATTCCACAAAGCCGCCGCGACCCGTCCCAGACGGT
GCTCTCTCTGCCAGAACAGCGTCTACTCCTCTCGCCGTTCGCCTCCGTCGCGACAAAAAATTCGGTCCTACCCAG
CCCGGCGCAGACGATGCCACGGCCGACGGCCTGACTCCCACCGACAATGCCCGCTACCGACGCCATCTTGCCTTG
GACCTCATTCCAAAGAAGGGCGGCGTCCCTCTTTCTCCTGCAGAGTGGATAAGTTTGCGCAACAGTCGGAGATCC
CGTCTGCGCGGTGTCAGAGGCGGACCAGAGGAACTTCGTGTTGTGGGGCAACCTGTGTATCTTCCCAACGTCATA
TTCCGTCTCGTTCGAAATCACACTCCTCCCGGTGAACCCTACAACCCTTATGAAGCCACCTTCCGTATCCCGCAC
TCCGTCACGAAGACCGATATACGCTCCTACCTTCTCGCTGTATATGGCGTCAAAACCACATATATCCGCACAGAC
AACTACTTTGCACCCGTCCCCAATAGAGGTCGAGCCCGCCAGACGTACAAATCCTATAAACGTGCTGTTGTCGGT
TTGGTTGACCCATTCTACTACCCACACCGTCTAGAAGATATGCCTCTAGAAAAACGGGAGGAACGTGAAAAGTGG
CTCGAAAGCAAACTCCGGTTGCAGGAGAACAAACAACTACGAAAGGAACAATTGTTGCGCGTCAGCAAGGGAACA
GTACTCAAGGCTCCCAACGTCACGAAGCGCTCGCATATCTTGAAGCTTGTTGCAGAGCGGAGGCAGAAGAGGGAA
GAACTGGTTTCTCAGATTGCTGGTGAATGGAAGGATATGAGAGAACAGGGAGAGAAGATCGTTTGGCCAGAAAAC
CCGATAGCCAGAGACTCTGCTGTACCTGCGGTAACAGAATCCTCTTCGTAA
Gene >AgabiH97|093590
ATGCAGTCTCTCTGCCGCTCCCTTTCGTCTCTCCGTCTCTATTCCACAAAGCCGCCGCGACCCGTCCCAGACGGT
GCTCTCTCTGCCAGAACAGCGTCTACTCCTCTCGCCGTTCGCCTCCGTCGCGACAAAAAATTCGGTCCTACCCAG
CCCGGCGCAGACGATGCCACGGCCGACGGCCTGACTCCCACCGACAATGCCCGCTACCGACGCCATCTTGCCTTG
GACCTCATTCCAAAGAAGGGCGGCGTCCCTCTTTCTCCTGCAGAGTGGATAAGTTTGCGCAACAGTCGGAGATCC
CGTCTGCGCGGTGTCAGAGGCGGACCAGAGGAACTTCGTGTTGTGGGGCAACCTGTGTATCTTCCCAACGTCATA
TTCCGTCTCGTTCGAAATCACACTCCTCCCGGTGAACCCTACAACCCTTATGAAGCCACCTTCCGTATCCCGCAC
TCCGTCACGAAGACCGATATACGCTCCTACCTTCTCGCTGTATATGGCGTCAAAACCACATATATCCGCACAGAC
AACTACTTTGCACCCGTCCCCAATAGAGGTCGAGCCCGCCAGACGTACAAATCCTATAAACGTGCTGTTGTCGGT
TTGGTTGACCCATTCTACTACCCACACCGTCTAGAAGATATGCCTCTAGAAAAACGGGAGGAACGTGAAAAGTGG
CTCGAAAGCAAACTCCGGTTGCAGGAGAACAAACAACTACGAAAGGAACAATTGTTGCGCGTCAGCAAGGGAACA
GTACTCAAGGCTCCCAACGTCACGAAGCGCTCGCATATCTTGAAGCTTGTTGCAGAGCGGAGGCAGAAGAGGGAA
GAACTGGTTTCTCAGATTGCTGGTGAATGGAAGGATATGAGAGAACAGGGAGAGAAGATCGTTTGGCCAGAAAAC
CCGATAGCCAGAGACTCTGCTGTACCTGCGGTAACAGAATCCTCTTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail